KEGG   Thermoanaerobacterium saccharolyticum: Tsac_1255Help
Entry
Tsac_1255         CDS       T02137                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
tsh  Thermoanaerobacterium saccharolyticum
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tsh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tsac_1255
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tsac_1255
   00052 Galactose metabolism
    Tsac_1255
   00500 Starch and sucrose metabolism
    Tsac_1255
   00520 Amino sugar and nucleotide sugar metabolism
    Tsac_1255
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Tsac_1255
   00524 Butirosin and neomycin biosynthesis
    Tsac_1255
Enzymes [BR:tsh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Tsac_1255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1301754..1302689
Genome map
AA seq 311 aa AA seqDB search
MRIGVDIGGTNIAVGLVDKDGKIVATGSRPTEPKRGYAAIAKDIAEISLELVKRCGLDVS
QIEAMGIGVPGVADNEKGIVLRAVNLYWTKVPLVKEIHKYIDVPINMDNDANVAALAEGI
FGAGKGTNSSVTITLGTGVGSGYILNGKVFNGSHHFAPELGHIVIGDNGVLCNCGKVGCL
ETFASATALIREGKKAVMENSDSLILKLAGGEIESITAKNVIDAARQFDEAAMLIFDDYV
KHLAIGIVNIINILDPEVVIIGGGVANAGDFLLKPLKEEVSKNILFKDLPYADIRKAELG
NDAGIIGAAIL
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaggattggtgttgatataggagggacaaacatagctgttggattagtcgacaaagac
ggtaagatagtagccacaggatcaaggcctacagagcctaagagaggatatgccgccatt
gctaaagatattgctgaaatttcattggagcttgtgaaaaggtgtgggcttgatgtatct
caaattgaggctatgggaattggtgttccaggtgttgctgataatgaaaaaggcattgtt
ttaagagctgtaaatctctattggacgaaggtgccgttagtaaaggaaatacataaatac
atcgatgtgcctataaacatggataacgatgcaaatgtagctgcacttgcagaaggcata
tttggagctggaaaaggtacaaattcgtctgtcaccataactctaggcacaggtgtaggt
tctggatatatattaaatggcaaggtgtttaacggttcgcaccattttgcccctgagctg
ggtcacattgtgattggcgacaatggggttttgtgcaattgcggcaaggttggctgtctt
gagacttttgcttctgcgacggctttaatcagagaaggcaaaaaagccgtcatggaaaac
agcgattcgcttatacttaaattggctggcggtgagattgaatccataacggctaaaaat
gtaattgatgctgcaagacaatttgacgaagcggcaatgctcatatttgatgactacgta
aagcatcttgccataggaatcgttaatatcataaacatacttgatccagaagttgtcatc
ataggaggcggcgttgccaatgctggtgatttccttctaaagccacttaaagaagaagta
agcaaaaatatacttttcaaagatctgccgtatgctgacatcagaaaggcagagcttgga
aatgatgcaggaataataggtgcggcaattctctaa

DBGET integrated database retrieval system