KEGG   Thermoanaerobacterium saccharolyticum: Tsac_1269Help
Entry
Tsac_1269         CDS       T02137                                 

Definition
glycoside hydrolase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
tsh  Thermoanaerobacterium saccharolyticum
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tsh00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1318255..1319649
Genome map
AA seq 464 aa AA seqDB search
MAKEYKFPEGFWWGSATSATQIEGAASEDGKGMNVWDYWYKQVPNRFFNGVGPEVTSDFY
HRYKEDIKLMKEIGHNSFRFSISWSRLIPGGVGEVNKKAVDFYNNVINELLENGIMPIAT
LFHFDMPIEMQHIGGFESRQVLENYKNYAKTCFELFGDRVKRWITFNEPIVPAEGGYLYN
FHYPDIVDFKKAIQVCFNTVLASAMAINEFKKSNIKDGKIGIVLNLTPSYPRSNHPADLK
AAEIADLLFNRSFLDPCVKGEYPEKLVELLKSYNHLPVYTEDDLELIKNNTVDYLGVNYY
QPRRVKAKENMPNPYGVFTPDWFFDEYVMPGRRMNPYRGWEIYEKGIYDILINVRDNYGN
IESYISENGMGVEGEERFIKDGVIQDDYRIDFIKGHLIWLHKAIEEGCNVKGYHLWSFMD
NWSFINAYKNRYGLVSVDISTQKRTIKKSGYWYKELAKNNGFSE
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagagtataaatttccagaaggtttttggtggggttctgccacatctgcaaca
cagatagaaggtgctgcaagcgaagacgggaaaggaatgaatgtatgggattattggtac
aagcaagtaccaaaccgcttttttaatggagtaggacctgaagtgacatctgatttttac
catagatataaagaagacataaaattgatgaaagaaataggacacaattcgtttagattt
tctatatcatggtcaagactgattccgggtggagtaggtgaagtaaacaaaaaagctgta
gatttctataataatgtcataaatgagcttttagaaaatggtattatgcctatagctact
ttgtttcacttcgatatgcctattgaaatgcagcacataggaggatttgaaagccgtcaa
gtcttggagaattacaaaaactatgctaagacatgctttgagctttttggagatagggta
aaaagatggattactttcaatgaacctatagttccagcagagggaggatacctttataac
tttcattatcctgatatcgtggattttaagaaagctatacaggtatgtttcaatacagtt
ttggcaagcgcaatggcaataaacgagttcaaaaaatcaaacataaaagatggaaaaatc
gggattgtattaaaccttactccatcatatcctcgtagcaatcatcctgcagatcttaag
gcggcagaaatagctgatcttcttttcaatagaagctttttagatccatgtgtcaaagga
gagtatcctgagaaacttgtagagcttttaaagagttacaatcatttaccggtgtatact
gaggatgatcttgaactcataaagaataatacggttgactatcttggagtaaattactat
cagccaagaagggttaaagcaaaggaaaacatgccaaatccttatggagtatttacgcct
gattggttttttgatgagtatgtaatgccaggaagaaggatgaatccgtacagaggatgg
gagatatatgaaaaaggaatatatgacatcttgataaatgtaagggacaactatggaaac
attgaatcgtatatttcagaaaacggcatgggcgtggaaggagaagaacgcttcataaaa
gacggtgtaatccaggatgattatagaatagattttatcaaaggtcatttaatatggctt
cataaggcgattgaagaaggatgcaatgtaaaaggctatcacctttggtctttcatggac
aactggtcatttataaacgcttataaaaatcgctatgggctcgtatcagtcgacatatca
acacaaaagaggactatcaagaaaagtggatattggtataaagaattagcaaaaaacaat
gggtttagcgaatga

DBGET integrated database retrieval system