KEGG   Thermoanaerobacterium saccharolyticum: Tsac_1276Help
Entry
Tsac_1276         CDS       T02137                                 

Definition
glycoside hydrolase family protein
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
tsh  Thermoanaerobacterium saccharolyticum
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:tsh00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Tsac_1276
Enzymes [BR:tsh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Tsac_1276
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1328410..1330488
Genome map
AA seq 692 aa AA seqDB search
MREYKPISEKYPHFLHGGDYNPDQWLYYPKILDEDIRLMKLANWNVVSLGIFAWAALEPE
EGNYQFKWLDSIMDKLYDNGIYVILATPSAAPPAWLLEKYPEVARVDSNRIRHLFGGRQN
HCFTSPIYREKVRNINRKLAERYKDHPALIAWHVSNEYGNDCHCNLCQEAFRNWLKKKYD
NDIKKLNHEWWSYFWSHTFTDWSQIQTPSPIGETTIHGLNLDYKRFVTDQTIDFFENEIA
PLKELTPNIPVTTNFMGTFPGLNYWKFAKHLDVISWDSYPTWHGNEEDWVVAYKTAFVHD
INRSLKSGQPFMLMESTPSVTNWQPVSKLKRPGMHVLSSIQAVAHGADTVQYFQWRKSRG
GFEKFHGAVVDHCGHENTRVFKDVKEVGEILKKLDSIIGTTVEPEVAIIYDWENNWAIED
AKGPRQEKKDYLLTCQSHYRPFWSKGVPVDVIDMESDFNRYKLLIAPMLYMIKEGVTEKI
KQFVKSGGTFVTTYLSGIANENDLCYLGGFPGPLKEVLGIWSEEIDALHDKDENYVVFNE
TNELGIKGEYKAKELCEIIHLEGGRDLAKYKGDFYAGYPAVTVNNYGNGKAYYIAFRNND
DFVDDFYDKIIELLDIKRTIDIDLPMGVTAQLRTDGNREFIFLLNFTDEEKKLDLKDIEY
IDIVDNSMLDGKVMLPPYGFKIIENRKQGVDR
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atgagagagtataaaccaataagtgaaaaatatccacattttctccatggaggcgactat
aatccagatcaatggctatattatcctaaaattttagatgaagacataagattgatgaaa
ttagctaattggaatgtggtaagtctaggcatatttgcttgggccgctttagaaccagaa
gaaggaaattatcaatttaaatggttggacagtataatggacaagttgtatgacaatgga
atatatgtcatacttgcaacacctagtgctgcacctcctgcatggcttcttgaaaagtat
ccagaagtagcgagggttgattcaaatagaataagacatctttttggagggaggcagaac
cattgttttacatctccaatatacagagaaaaagtgagaaatatcaatagaaaacttgca
gagagatataaggaccatccagctttgattgcttggcatgtatcaaatgaatacggaaat
gattgtcattgcaatttatgtcaagaagcattcagaaattggcttaagaaaaaatacgat
aatgatataaaaaaattaaatcatgaatggtggagctacttttggagccatacatttaca
gattggtcacagatacaaacgccatcaccaattggcgaaacaactatacatggattaaac
ttggattacaagagatttgtaacagatcagactatagatttttttgaaaatgagattgca
cctttaaaagagctaacaccaaatatccctgtaacaactaattttatggggacttttccg
ggacttaactattggaaatttgcaaaacatcttgatgtcatatcatgggacagttatcca
acttggcatggaaatgaagaagattgggtagttgcatataaaacagcatttgttcatgac
ataaatcgctcccttaaaagtgggcagccattcatgctgatggaaagcacaccaagtgtt
acaaattggcagcctgtctcaaaattaaaaagaccaggaatgcatgttttatcatcaata
caggcagttgctcatggagcagatactgttcagtattttcaatggagaaaaagcaggggc
ggatttgaaaaatttcatggtgcagtagtggatcactgtggacatgagaacacaagagta
tttaaagatgttaaagaagtgggagaaatactaaaaaagttagattcgattataggtaca
actgtagaaccagaggtggctataatttacgattgggagaacaattgggcgatagaagat
gcaaaaggcccaaggcaagaaaaaaaagattaccttttgacgtgtcaatcacattatagg
ccattttggagtaaaggtgttccggtagatgtgatcgacatggaaagcgattttaataga
tacaagctgttgatagctccaatgctttacatgataaaagaaggtgtaactgaaaaaata
aaacaattcgtaaaaagtggtggaacttttgtaacgacgtatttaagtggcatagcaaac
gaaaatgatctttgttatctaggtggttttccaggaccgctaaaagaggtattggggatt
tggagcgaagaaatagatgcattgcacgataaagatgaaaattatgtagtttttaatgaa
actaatgaattaggtattaaaggtgaatataaggcgaaagagctttgcgaaattattcat
cttgaaggaggaagagatttagccaagtataaaggagacttttatgcaggttatcctgct
gtgacagttaataattatggtaatggaaaggcatattatatagcatttagaaataatgat
gattttgtggatgatttctatgacaaaataatagaacttttagatataaaaagaacgata
gatattgatttgccaatgggcgttactgctcaattacgaacagatggaaatagagaattt
atattcttgttaaacttcacagatgaagaaaagaaattagatctaaaagacattgaatat
atagatatagtagataatagcatgttagacggaaaagttatgttgccgccttatggattt
aagattatagaaaatagaaaacaaggggttgatagataa

DBGET integrated database retrieval system