KEGG   Thermoanaerobacterium saccharolyticum: Tsac_1362Help
Entry
Tsac_1362         CDS       T02137                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tsh  Thermoanaerobacterium saccharolyticum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tsh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tsac_1362
   01230 Biosynthesis of amino acids
    Tsac_1362
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tsac_1362
   00030 Pentose phosphate pathway
    Tsac_1362
   00051 Fructose and mannose metabolism
    Tsac_1362
   00052 Galactose metabolism
    Tsac_1362
  Energy metabolism
   00680 Methane metabolism
    Tsac_1362
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Tsac_1362
Enzymes [BR:tsh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Tsac_1362
Protein phosphatases and associated proteins [BR:tsh01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Tsac_1362
Messenger RNA biogenesis [BR:tsh03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Tsac_1362
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1429766..1430731
Genome map
AA seq 321 aa AA seqDB search
MRTIGVLTSGGDAPGMNAAIRAVVRCGIYNGLTVKGIMRGYQGLIDDEIEDMTLSSVGDI
IQRGGTILRTARSAEFKTKEGRAKAAEVLKKHNIEGLVVIGGDGSFRGAQLLSNEHGVNT
IGIPGTIDNDIPCTDYTIGFDTACNTAIDAINKIRDTATSHERANIIEVMGRNAGYIALY
AGLAGGAEIIIIPEVKFDIDEVCEKISYGIKRGKLHHIIVLAEGVMSGLELSKMIQERLP
KLDLRHTTLGHIQRGGAPTVMDRVIASQMGSRAVELLLENKSQRIISIRNNQIVDDDIDT
ALAMKKEFNLKLYELSKILSI
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgagaacaataggagttttaacaagtggtggagatgcaccaggcatgaatgctgccata
agggcagtggtaagatgcggcatatataacgggctgacagtaaaaggcatcatgagaggc
tatcaggggcttatagacgacgagatagaagacatgacattgtcatcagtaggtgacata
attcaaagaggcggtacaatacttcgtacagccagaagtgcagaatttaaaacaaaagaa
ggaagagccaaggctgcagaggtattgaaaaagcacaatattgaagggcttgtggtcata
ggcggagatggctcttttagaggtgcacagcttttaagtaatgaacatggtgttaatacg
atcggtattccaggcactatcgacaatgacataccgtgtacagattatacaatcggtttt
gatacagcttgcaatacggctatagatgccatcaacaagattagagacacggcaacgtca
cacgaaagagcaaatatcatagaggtaatgggaagaaatgctgggtacatagcgctttat
gcaggacttgctggaggagcagagattataataataccggaagtcaagtttgacatagat
gaagtgtgcgaaaaaatttcgtacggcataaagaggggcaagctgcatcacataattgta
ctggcagaaggtgtaatgagcggtctggagttatcaaagatgattcaagagagacttcct
aagcttgatttaaggcatacgactttgggccacatacaaaggggtggcgcgcctactgtc
atggacagagttatcgcaagccaaatgggatcaagagctgtagagcttctgttagaaaac
aaatctcaaaggataataagcataagaaataaccagattgtggatgatgatatagacact
gctttggcaatgaaaaaagagtttaatttaaagctttatgaactcagcaaaatattatca
atttaa

DBGET integrated database retrieval system