KEGG   Thermoanaerobacterium saccharolyticum: Tsac_1365Help
Entry
Tsac_1365         CDS       T02137                                 

Definition
glucan 1,4-alpha-glucosidase
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
tsh  Thermoanaerobacterium saccharolyticum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tsh00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Tsac_1365
Enzymes [BR:tsh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     Tsac_1365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1433113..1435224
Genome map
AA seq 703 aa AA seqDB search
MNRKLIKYLPVLFLASSVLSGCGNNNISSMKIERLNNVQAINGPGEADTWAKAQKQCVGT
ANNYTSKVWFTLADGAISEVYYPTIDTADVKNIKFFVTDGKTFVSDETKDTITKVEKFTE
KSLGYKIINTDKVGRYKITKEVFTDVKRNSLIIKTKFEALKGNVDDYRLYVMCDPHVKNQ
GKYNEGYAVKANGNVALIAERDGIYTALSSDVGWKKYSIGYYKVNDIETDLYKNMQMTYN
YNSARGNIIEGAEIDLKKNTQFEIVLSFGQSENEAVRTNMETLNDDYGSLKKAYIDEWEK
YCNSLNDFGGKANSLYFNSMMILKASEDKTNKGAYIASLSIPWGDGQEDDNIGGYHLVWS
RDLYHVANAFIVAGDTDSANRALDYLVKVVKDNGMIPQNTWINGKPYWTGIQLDEQADPI
ILSYRLKRYDLYESLVKPLADFIVKIGPKTGQERWEEIGGYSPATLASEVAGLTCAAYIA
EENKDFESAKKYQEKADNWQRLIDSLTYTEKGPLGNGQYYIRIAGLPDPNADFMISIANG
GGVYDQKEIVDPSFLELVRLGVKSADDPKILNTLKVVDETIKVDTPKGPSWYRYNHDGYG
EMSKTELYHGTGKGRLWPLLTGERGMYEIAAGKDATSYVKAMENFANESGIISEQVWEDT
GLPTDSASPLNWAHAEYVILFASNIEHKVLDMPDIVYKRYASK
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
ttgaatagaaaacttataaaatacctacctgtattatttcttgcatccagtgtgctaagc
ggatgtggaaacaataatatatcaagtatgaaaattgaaagattaaataatgtgcaagca
ataaatggcccgggagaggccgatacatgggcaaaagcccagaaacaatgtgtaggtact
gcaaacaactatacttccaaagtgtggtttacacttgcagacggagcgatatctgaggtt
tactatcccactatagatactgctgatgtaaaaaatattaaattttttgtgacagatgga
aaaacgtttgtctctgacgagacaaaagacacaataaccaaagtagaaaagttcactgaa
aaatcgttaggttataaaatcattaacacagataaagttgggagatataagataactaaa
gaagtatttactgatgtaaagcgaaattctctcataattaagacgaaatttgaagcttta
aaaggcaatgttgatgattacagactttatgtaatgtgtgatcctcatgtaaaaaatcag
ggcaaatacaatgaaggatacgcagttaaggcaaatggcaatgttgcgctaattgctgaa
agagatgggatttacactgcattgtcttctgatgtaggctggaaaaagtattcgataggt
tattataaagtaaatgatattgagaccgatctttataaaaacatgcaaatgacttacaat
tacaatagtgcaagaggcaacatcatagaaggtgctgaaatagatcttaagaaaaatact
caatttgaaatcgtattgtctttcggacaaagtgaaaatgaagcggtaaggacaaacatg
gaaactttaaatgatgattatggcagtttaaagaaggcgtatatagacgaatgggagaag
tattgcaatagccttaatgattttggcggaaaagcaaattcactgtatttcaatagcatg
atgatattaaaagccagtgaagacaagacaaacaagggtgcttatatagcatcgctatca
atcccatggggtgatggccaagaagatgacaatatcggtggttaccatcttgtatggtca
cgagatctgtaccatgtagcaaatgcatttattgttgctggcgatactgattcggcaaac
agagcgttggattatttagtcaaagtagtaaaagacaatggaatgattccacaaaataca
tggataaatggaaagccttattggacaggcatacagcttgatgagcaggcagacccaata
atattaagctacaggcttaaaagatacgatctctatgaaagccttgttaagcctttggcg
gatttcattgtgaaaataggccctaagacgggacaggaaagatgggaagaaataggagga
tattcaccagcaacgctggcttcagaagtagcaggacttacatgtgctgcgtatatagct
gaagaaaataaggattttgaatctgctaaaaagtatcaagaaaaggcggacaactggcaa
aggcttattgacagcctaacttacacagaaaaaggtcctttgggaaatggtcaatactat
ataaggatagcaggacttccagatccaaatgctgatttcatgataagcatagcgaatggc
ggtggtgtatacgaccaaaaagaaatcgtggatccaagttttctggaacttgtaaggctt
ggagtaaaatcagcagatgaccctaaaatactaaatacgctgaaagtcgtagatgaaaca
ataaaagtcgatacgccgaaaggaccgtcgtggtacaggtataatcatgatggatatggc
gagatgtctaagacagaactatatcatgggacagggaagggaagattgtggccgctgctt
acaggtgagagaggcatgtacgagattgctgcagggaaagatgcgacatcttatgtaaaa
gccatggagaactttgcaaatgaaagcggcataatatctgagcaagtatgggaagatact
ggacttcctacagattcagcatcaccgcttaattgggcacatgccgaatacgtaatatta
tttgcatcgaatatagaacataaagtgcttgacatgccagacattgtttataaaaggtat
gcttcgaagtga

  All links  
No link information was found.   
DBGET integrated database retrieval system