KEGG   Thermoanaerobacterium saccharolyticum: Tsac_1564Help
Entry
Tsac_1564         CDS       T02137                                 

Definition
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
tsh  Thermoanaerobacterium saccharolyticum
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:tsh00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Tsac_1564
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Tsac_1564
Enzymes [BR:tsh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Tsac_1564
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1642860..1644314
Genome map
AA seq 484 aa AA seqDB search
MRLVDILKDVKYTIVKGNIDVDVKGICYDSRNSKEGSLFVAIKGFKFDGADYINDAVEKG
AIAVAVEHEVSIDKDITVIKVENARKSLAKIASNYYGDPSKQLFMIGVTGTNGKTSVTYM
IKSILESQNNKVGLIGTIHNMIGDKVYPTERTTPESLDLQRYLRLMVDEGVKYVVMEVSS
HSLALNRVDECKFDIAVFTNLTQDHLDFHKTMDEYANAKAKLFRMAKTACVINIDDDYSS
FMIENSNAKVVTYGIKDYAYIMAKDIKNDIKGAKFTVQIEDIKSEIALKIPGLFSVYNSL
AAISVAFILGIPLQSVKMALKDVKIKGRFEVLDLEVPYNVVIDYAHTPDGLENLMKAFGE
YNTGKKILLFGCGGDRDKGKRPKMGEVAGKYADFVIITSDNPRSEEPIDIIREIEKGIKN
TKCPYTIIEDRKEAIKYALSIAKDNDVVILAGKGHETYQVLKDKVIDFDERDIVREILNG
DEKS
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgagacttgtggatatattaaaagatgtgaaatatacgattgtgaaaggaaatatcgat
gttgatgtaaaaggcatttgttatgattcgagaaattcaaaagaaggttcgctgtttgta
gcaattaaagggtttaagtttgacggtgctgattacataaatgatgctgtagaaaaagga
gccattgccgtcgcagttgaacatgaagtaagcatagataaagacattaccgtcataaaa
gtagaaaatgccagaaaatcattggctaaaattgcatcaaattattacggtgatccttca
aagcagctttttatgataggtgtgacgggaacaaacggtaagacttctgtcacctacatg
ataaagtccatacttgaaagccagaacaataaagttgggttgatagggacgattcacaat
atgattggcgataaagtttatccaactgagaggactactcctgagtcattagatcttcaa
agataccttcgactcatggttgatgagggtgtgaaatacgtggtgatggaggtttcatcg
cattcattggcgttaaatagagtagatgaatgcaaattcgacatagcagtttttacaaat
ttaactcaagatcatttagattttcacaagacgatggatgaatatgccaatgcaaaggcg
aaactttttaggatggcaaagacagcttgcgtgataaacatagatgatgattattcttca
tttatgatagaaaattctaatgctaaagttgtaacgtacggcataaaagattatgcatac
ataatggcaaaagacatcaaaaacgatattaaaggtgcgaaattcactgtccaaattgaa
gatataaaaagtgaaatagctttaaagataccagggttatttagtgtttacaactcactg
gcggctatttcagtagcatttatattgggtataccgcttcagtccgtaaaaatggctctt
aaggatgtcaagataaaaggcagatttgaagttcttgacttggaggtgccttacaatgtg
gtaattgactacgcacatactccggacggacttgagaatttaatgaaggcatttggtgaa
tacaatactgggaaaaagatattgctttttggatgtggtggcgacagagataaaggcaaa
cgccctaagatgggagaagttgctggcaaatatgctgattttgtaattataacttcggac
aatccaaggtcggaagaacctattgatataataagggaaattgaaaaaggcattaaaaat
acaaagtgcccctatacaatcattgaagataggaaagaggccataaagtatgcactatct
atagcaaaggacaatgatgtagtgattttagcaggcaaagggcatgaaacatatcaagta
ttaaaagataaagttatagattttgatgaaagagacatagtaagagagatattaaatgga
gatgaaaaaagttga

DBGET integrated database retrieval system