KEGG   Thermoanaerobacterium saccharolyticum: Tsac_1564Help
Entry
Tsac_1564         CDS       T02137                                 

Definition
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
tsh  Thermoanaerobacterium saccharolyticum
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:tsh00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:tsh00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1642860..1644314
Genome map
AA seq 484 aa AA seqDB search
MRLVDILKDVKYTIVKGNIDVDVKGICYDSRNSKEGSLFVAIKGFKFDGADYINDAVEKG
AIAVAVEHEVSIDKDITVIKVENARKSLAKIASNYYGDPSKQLFMIGVTGTNGKTSVTYM
IKSILESQNNKVGLIGTIHNMIGDKVYPTERTTPESLDLQRYLRLMVDEGVKYVVMEVSS
HSLALNRVDECKFDIAVFTNLTQDHLDFHKTMDEYANAKAKLFRMAKTACVINIDDDYSS
FMIENSNAKVVTYGIKDYAYIMAKDIKNDIKGAKFTVQIEDIKSEIALKIPGLFSVYNSL
AAISVAFILGIPLQSVKMALKDVKIKGRFEVLDLEVPYNVVIDYAHTPDGLENLMKAFGE
YNTGKKILLFGCGGDRDKGKRPKMGEVAGKYADFVIITSDNPRSEEPIDIIREIEKGIKN
TKCPYTIIEDRKEAIKYALSIAKDNDVVILAGKGHETYQVLKDKVIDFDERDIVREILNG
DEKS
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgagacttgtggatatattaaaagatgtgaaatatacgattgtgaaaggaaatatcgat
gttgatgtaaaaggcatttgttatgattcgagaaattcaaaagaaggttcgctgtttgta
gcaattaaagggtttaagtttgacggtgctgattacataaatgatgctgtagaaaaagga
gccattgccgtcgcagttgaacatgaagtaagcatagataaagacattaccgtcataaaa
gtagaaaatgccagaaaatcattggctaaaattgcatcaaattattacggtgatccttca
aagcagctttttatgataggtgtgacgggaacaaacggtaagacttctgtcacctacatg
ataaagtccatacttgaaagccagaacaataaagttgggttgatagggacgattcacaat
atgattggcgataaagtttatccaactgagaggactactcctgagtcattagatcttcaa
agataccttcgactcatggttgatgagggtgtgaaatacgtggtgatggaggtttcatcg
cattcattggcgttaaatagagtagatgaatgcaaattcgacatagcagtttttacaaat
ttaactcaagatcatttagattttcacaagacgatggatgaatatgccaatgcaaaggcg
aaactttttaggatggcaaagacagcttgcgtgataaacatagatgatgattattcttca
tttatgatagaaaattctaatgctaaagttgtaacgtacggcataaaagattatgcatac
ataatggcaaaagacatcaaaaacgatattaaaggtgcgaaattcactgtccaaattgaa
gatataaaaagtgaaatagctttaaagataccagggttatttagtgtttacaactcactg
gcggctatttcagtagcatttatattgggtataccgcttcagtccgtaaaaatggctctt
aaggatgtcaagataaaaggcagatttgaagttcttgacttggaggtgccttacaatgtg
gtaattgactacgcacatactccggacggacttgagaatttaatgaaggcatttggtgaa
tacaatactgggaaaaagatattgctttttggatgtggtggcgacagagataaaggcaaa
cgccctaagatgggagaagttgctggcaaatatgctgattttgtaattataacttcggac
aatccaaggtcggaagaacctattgatataataagggaaattgaaaaaggcattaaaaat
acaaagtgcccctatacaatcattgaagataggaaagaggccataaagtatgcactatct
atagcaaaggacaatgatgtagtgattttagcaggcaaagggcatgaaacatatcaagta
ttaaaagataaagttatagattttgatgaaagagacatagtaagagagatattaaatgga
gatgaaaaaagttga

DBGET integrated database retrieval system