KEGG   Thermoanaerobacterium saccharolyticum: Tsac_1654Help
Entry
Tsac_1654         CDS       T02137                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
tsh  Thermoanaerobacterium saccharolyticum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tsh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Tsac_1654
Enzymes [BR:tsh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Tsac_1654
Exosome [BR:tsh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Tsac_1654
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1731699..1732673)
Genome map
AA seq 324 aa AA seqDB search
MRLLKRPRRLRGNETIRSMIRETSINIDDLIYPMFVVPGENIKEEISSMPGIYRFSIDNL
LKEVKEINELKIPAILLFGIPSKKDELGSEAYDENGIIQQAIKSIKNAIPEMLIITDVCM
CEYTSHGHCGIVKDGYVQNDETTSYIAKIALSHVIAGADIVAPSDMMDGRVKAIRDVLDE
NGYVNTPIISYSAKYASSFYGPFREAAESAPQFGDRKSYQMDPANSDEALREISLDIEEG
ADIIMIKPALPYLDIIRRAKDTFNIPIAAYNVSGEYSMIKAASQMGYIDEKSAVLESLTG
IKRAGADIIITYFAKDVAKWLTIL
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgagactgctaaagaggccaagaaggcttagaggaaacgaaactataaggagtatgatt
agagagacttctataaatattgatgatttgatatatcctatgtttgtcgtacctggagaa
aacataaaagaagaaattagttctatgccaggcatataccgtttttctattgacaatctt
ttaaaagaagttaaagagataaacgagttaaagataccagctatattgctttttggcata
ccatcaaaaaaagatgaattaggctctgaagcttacgacgaaaacggaataattcaacaa
gccataaaatccataaaaaatgcaatacctgaaatgcttattataacagatgtgtgcatg
tgcgagtatacaagtcatggccattgtggcattgtaaaagatggctatgtgcaaaacgac
gaaacgacttcatacattgcaaaaatcgctttatcccatgtgatagcaggtgcagacatc
gtagcaccttctgacatgatggatggacgtgtaaaagcaataagagacgttttagatgaa
aatggatatgtaaacacaccaataatatcttacagcgctaaatatgcatcgtcattttat
ggtcctttcagagaagcggcagaatcagcaccacaatttggcgataggaaatcataccaa
atggatcctgcaaactctgacgaagctttaagagaaatctcacttgatatagaggaaggt
gctgacataataatgataaaaccagcacttccgtatcttgatataataagaagggcaaaa
gatacattcaatatcccaatcgcagcctacaatgtaagcggtgaatactcaatgataaaa
gccgcatctcagatgggatatattgatgaaaaatcagcagttttggaatcattgactgga
ataaaaagggctggcgcagatatcataataacctactttgctaaggatgttgcaaaatgg
cttactatcctataa

DBGET integrated database retrieval system