KEGG   Thermoanaerobacterium saccharolyticum: Tsac_1681Help
Entry
Tsac_1681         CDS       T02137                                 

Definition
Holliday junction DNA helicase subunit RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
tsh  Thermoanaerobacterium saccharolyticum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:tsh00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Tsac_1681
Enzymes [BR:tsh01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Tsac_1681
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1751032..1751592
Genome map
AA seq 186 aa AA seqDB search
MIDYIKGYIVEKGIDYVVIETLGIGFKIIVPRSTLSQLTTTSEMVKLYTYMHVKEDGFQL
YGFLTINEVEIFKKLIAVNGVGPKAAVSILSTISIENFYDAIRNSDSKAIEKSPGIGKKT
AQRIILELKDKLTFGHEAKLDDSSNDVVDALLSLGYTKQESIKALEGVDCSNLESALKEA
LKKLMK
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgatagattatataaaaggttatattgttgaaaaaggcattgattatgtcgttattgaa
acgcttggcataggttttaaaataatagtgccaaggagcactttaagccagttgacaact
acaagtgagatggttaagctttatacatatatgcatgttaaagaagatggatttcaactt
tatggatttttgacgataaatgaggtagaaatttttaaaaagttaatagctgtaaatgga
gttggacctaaagcagcagtatcaatattatcaacaatatctattgaaaatttttatgat
gccataagaaatagcgattcgaaagccatagagaaatcaccaggtattgggaagaaaacc
gcacagaggataatattagagcttaaagacaagctaacgtttggtcatgaggcaaaactt
gatgattcatcgaatgatgtggttgatgcactgttatcgcttggatatacgaaacaggag
tccataaaagcattagaaggagtagactgttcaaatttagagtctgctttaaaagaggca
ctgaaaaagcttatgaaataa

DBGET integrated database retrieval system