KEGG   Thermoanaerobacterium saccharolyticum: Tsac_1702Help
Entry
Tsac_1702         CDS       T02137                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
tsh  Thermoanaerobacterium saccharolyticum
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tsh00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Tsac_1702
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Tsac_1702
Enzymes [BR:tsh01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Tsac_1702
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1771963..1772895
Genome map
AA seq 310 aa AA seqDB search
MIGKDVLGIREMSKEDLLEILDTAGEMKKILVGNKDSDILRGKTVVTIFFEPSTRTRLSF
EMAAKYLGAHFGNIETKTSSVVKGESLIDTVRTIEKMKADVIVVRHNMSGAPHLMAKYLD
ASVINAGDGLNEHPTQALLDLMTIREKKGFFDGLKVVIVGDIVHSRVARSNIWGLQKLGA
EVRLVGPATLLPKTFEKLGAKVYYDIDKAVDGVDVVMGLRIQLERQKNGLFPSKDEFSKY
FGITEERMGLAKKDAILMHPGPINRNVELTSKAANATYSVIEEQVTNGVAVRMALLKILC
ERRKSNEISY
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgataggaaaagatgtgttaggcataagggaaatgtcaaaagaagatcttttagaaata
ctggatacggcaggagaaatgaagaaaatcttagttggtaataaagattctgatattttg
agaggaaagacagtcgttacgatattttttgagccaagcacaaggacaagattgtcattt
gaaatggcggcaaaataccttggagcgcattttggaaacatagagaccaaaacaagcagc
gtcgtaaaaggtgaatcacttattgatacagtaagaacgatagaaaaaatgaaagcagat
gtaattgtagtgcgtcacaatatgtctggtgctccacatcttatggcaaaatatctcgat
gcatcagtaataaatgcaggtgatggtcttaacgaacatcctacacaggctttgttggat
ttaatgacaataagagaaaagaaaggattctttgacggcttaaaagtagtaatagttgga
gatatagtccattcaagagtcgcaaggtctaatatatgggggttgcaaaaattaggtgct
gaagttagattggtgggtcctgctacattattgccaaagacttttgaaaagcttggagca
aaagtctattatgacatagacaaagctgttgatggagttgatgtagtcatgggacttaga
attcaattagaaaggcagaaaaatggcttgtttccatcaaaagatgaattctcaaagtac
tttggtataacagaagaaagaatgggacttgcaaaaaaagatgcaatactaatgcatcct
ggacctatcaatagaaatgtggaacttacatcaaaagcagctaatgccacatattcagtt
attgaggaacaggttacaaatggcgtagctgtaagaatggcattattaaaaatattatgt
gaaaggagaaaatcaaatgaaattagttattaa

DBGET integrated database retrieval system