KEGG   Thermoanaerobacterium saccharolyticum: Tsac_1818Help
Entry
Tsac_1818         CDS       T02137                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
tsh  Thermoanaerobacterium saccharolyticum
Pathway
tsh00900  Terpenoid backbone biosynthesis
tsh01100  Metabolic pathways
tsh01110  Biosynthesis of secondary metabolites
tsh01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tsh00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Tsac_1818
Enzymes [BR:tsh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Tsac_1818
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C Mur_ligase PrpR_N Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: AFK86824
UniProt: I3VWC9
Position
1877187..1878335
Genome map
AA seq 382 aa AA seqDB search
MKNIVILGSTGSIGTQTLDVVRKSKEFQVIGLTCYNNIDLIKQQIDEFNPKFVAVKDKSS
AKKLKEMVDTNTVILSGDDGINEVASLSNVQTVVVAIEGIAALIPTIKAIETGHDIALAN
KECLVTGGHIIKKLAIEKNINIFPVDSEHNAIYQCIQSGKKEFVNKLIITASGGPFRGKT
LNDLKSVTVEEALNHPNWKMGKKITIDSATLMNKGFEVIEANWLFDMPLEKIEVVVHKES
IIHSMVEFIDGSIIAEMATADMRIPIQYALNFPNRVYVEGVRYLDIAKIASLSFEKPDVN
TFRCLQLAYDALREGGTMTTVLNTADEVAVQLFLERAISFNDIPCIIEKYMNSHKNIINP
ELNDIIEVDKEIREKIKREYMR
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatattgtcattttaggttctacgggttcgattgggactcaaacactcgacgta
gtaagaaaatcaaaagaatttcaagttataggacttacatgttataataatattgatctt
ataaagcaacaaattgatgaatttaatccgaaatttgtagctgttaaagataaatcttct
gcaaaaaagttaaaagaaatggtagatactaatacagtgattctctctggtgatgatgga
ataaacgaggtagcttctctttcaaatgttcagactgttgttgtagcaattgaaggcata
gcagcgcttattcctactataaaagcgattgaaacaggacatgatattgcacttgctaat
aaagaatgtttagtaactggtgggcacataattaagaaactggcaattgagaaaaacata
aatatattccctgttgatagtgagcacaatgcgatttaccaatgcattcaatctgggaaa
aaggaattcgtaaataaattgattataactgcatctggaggaccatttagaggtaaaaca
ttaaacgatttaaaatcggtgacagttgaagaagctttaaatcaccctaattggaagatg
ggcaagaagataacaattgattctgccacacttatgaataaagggtttgaggtaatagaa
gctaattggctttttgatatgccgttagaaaaaatagaagttgttgtgcataaagaaagc
ataatacattcaatggtagagtttattgatggaagcattattgcagaaatggcgactgct
gatatgaggataccgatacagtacgctttaaattttccaaacagggtatatgtagaaggc
gtacgatatttagatattgccaaaattgcaagtttatcatttgaaaaaccagatgttaat
acttttagatgtctccaactggcgtatgacgcattgagagaaggcggaacaatgacaact
gttttaaatacagcagatgaagtagcagttcaattatttttagaaagagcaatttcgttt
aatgatattccttgtataatagaaaaatatatgaatagtcataaaaacatcattaatccg
gaattaaatgatataatagaagtagataaagaaataagggaaaaaattaagcgtgagtat
atgaggtga

DBGET integrated database retrieval system