KEGG   Thermoanaerobacterium saccharolyticum: Tsac_1944Help
Entry
Tsac_1944         CDS       T02137                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
tsh  Thermoanaerobacterium saccharolyticum
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:tsh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Tsac_1944
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Tsac_1944
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Tsac_1944
Enzymes [BR:tsh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Tsac_1944
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1995750..1996844)
Genome map
AA seq 364 aa AA seqDB search
MKIVVKVGTSTLTYENGKLNLEMMEKIVRQISNLQNKGDKVVLVTSGAIGAGMGKLNILK
RPKTLPEKQSLAAIGQGLLIGLYEKFFNEYGKTTAQLLLTKDDFSIRERYLNISYTLSNL
LRYNVVPIINENDTVTVDEIKIGDNDTLSALVASIVEADLLIILTDIDGLYDRDPKADGA
KLIDVVYDFSDALFEIAGGSGTDFGTGGMYTKIQAAKICYNSGVKMVIANGKLDNVLNKI
VAGERIGTVFMPAKNPISNRKVWIAFNAQLSGKLTIDDGARQAILENGKSLLPSGIISTD
GEYSVGDCVSIYDEHGKEIARGLINYTSDEVSKIKGLKSTEIDKVLGYKNYDEVVHRDNL
VVIV
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgtcgtaaaagtcggaacaagcacattgacttatgaaaacggaaaattgaat
ttagaaatgatggaaaaaattgtacgtcaaatatctaatttgcaaaacaaaggcgataaa
gttgttcttgtgacatctggtgcaattggagctggaatgggaaaactaaatattttgaaa
agacctaagacactaccggaaaaacaatcgttggcggcaattggacaaggattgctgatt
ggactatatgaaaaattttttaatgaatatgggaagactacagctcagcttttacttaca
aaggacgatttttctataagagaaaggtacttaaacataagctatacattatcaaactta
ttaaggtataatgtagttccaatcataaatgaaaatgatactgttactgtagatgaaata
aaaataggtgacaatgatactctatcagcacttgtagcaagcattgtagaagcggatctt
ttaattatattgactgatattgatgggctatatgatagagatcctaaagcagatggagct
aagctgatagatgtagtttatgatttttctgatgcgctttttgaaattgctggtggctct
ggcacagattttggcacaggtggtatgtatacgaagattcaagcggcaaaaatttgttac
aactcaggtgtcaaaatggtaattgccaatggcaagcttgataatgttttaaacaagatt
gtagcaggtgaaagaatagggacagtttttatgcctgctaaaaatcctatcagcaataga
aaggtatggatcgcgttcaatgcacaattatcaggtaagctgactattgatgatggggca
agacaggccatacttgaaaatggaaaaagcttattgccaagtggtattatatcaactgat
ggagaatattctgtaggggattgtgtatcaatatatgatgagcatggaaaagagattgca
agaggtttgattaattatacatctgacgaagttagcaaaataaagggtttaaaatcaact
gaaatagacaaagttttaggatataaaaattacgatgaagttgtccacagagacaattta
gttgtcatagtttaa

DBGET integrated database retrieval system