KEGG   Thermoanaerobacterium saccharolyticum: Tsac_2009Help
Entry
Tsac_2009         CDS       T02137                                 

Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
tsh  Thermoanaerobacterium saccharolyticum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tsh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Tsac_2009
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tsac_2009
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Tsac_2009
Enzymes [BR:tsh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Tsac_2009
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2054485..2055309)
Genome map
AA seq 274 aa AA seqDB search
MMLSSVEVNNARENRIDKKFNELKKKGRKALIAFITAGDPDINITINLVYKMVEGGADII
EIGIPYSDPLADGPIIQASSARALKKGTKIDDIMSAVNIIRQNTDVPLVYLAYYNSIYKY
GMEKFLKNAKDSGIDGLIIPDLPLEERKDIKELSEKHDIYLIPLVAPTSNDRIKKICENG
KGFVYCVSTKGVTGVRNSIETDIEKYMDLVSKYTDLPKAIGFGISGPEMAKKFAPYCDGI
IIGSAIVKMISDSRNNDEIFDSVANFISSVKEVI
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgatgttgtcaagtgtagaagttaacaatgcaagggaaaacaggattgataaaaaattc
aatgaattaaagaaaaaagggcgtaaagcgctgattgcatttataaccgctggagatccc
gatataaatataaccatcaatttagtgtataagatggttgaaggcggggctgatatcata
gagattggaattccatattcggacccgctggcagatggacctataatacaagcttcatct
gcaagggcattgaaaaagggcactaaaatagatgatataatgagtgctgttaatataata
agacaaaatacagatgtaccgcttgtgtaccttgcctattacaattccatttataaatat
ggaatggagaaatttttaaagaatgcaaaggattctggcatagatggactaattatacct
gatttgccattggaggaaagaaaagacataaaagaattatcagaaaaacatgatatttat
ttgataccattagttgcacctacttcaaatgacaggataaaaaagatttgtgaaaatggc
aaaggatttgtgtattgtgtttccacaaaaggtgtcacaggtgtaaggaattctattgaa
actgatattgaaaagtacatggatttggtatcaaagtacactgatttgccaaaagcaatt
ggatttggcatatctggacctgagatggcaaaaaaatttgctccgtactgtgatggaata
ataattggcagtgcaatagttaaaatgataagtgattcaagaaataatgatgaaatattt
gatagtgtggcaaatttcatatcatcagtcaaagaggtaatttaa

DBGET integrated database retrieval system