KEGG   Thermoanaerobacterium saccharolyticum: Tsac_2010Help
Entry
Tsac_2010         CDS       T02137                                 

Definition
(GenBank) Tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tsh  Thermoanaerobacterium saccharolyticum
Pathway
tsh00260  Glycine, serine and threonine metabolism
tsh00400  Phenylalanine, tyrosine and tryptophan biosynthesis
tsh01100  Metabolic pathways
tsh01110  Biosynthesis of secondary metabolites
tsh01130  Biosynthesis of antibiotics
tsh01230  Biosynthesis of amino acids
Module
tsh_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tsh00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tsac_2010
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Tsac_2010
Enzymes [BR:tsh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Tsac_2010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AFK87014
UniProt: I3VWW9
Position
complement(2055306..2056481)
Genome map
AA seq 391 aa AA seqDB search
MVGRFGKFGGQYVPETIMNALIELEDEFYKAINDKDFIDEYKYYLREYSGRPTPLYFARN
LTERLGGAKIYLKREDLNHTGAHKINNVLGQILLAKRMGKRKVIAETGAGQHGVATATGA
AMFDMECEIFMGEEDIKRQSLNVFRMKLLGAKVTPVKTGTGTLKDAVNEAIRNWVTNIDD
TFYVMGSVVGPHPYPIMVRDFQRVIGDETREQILSKEKRLPDYIVACVGGGSNSMGIFYP
FINDSSVKLIGVEAAGLGIDTNKHAATMAKGSIGVLHGMMTYLLQDDEGQIMPVYSISAG
LDYPGVGPEHAYLRDTGRAQYVYATDEEALSAFMDLSQIEGIIPALESAHAVAYAMKLAP
SLSKDDIIVVNLSGRGDKDVNTVANVLEVEL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggtagggagatttggtaaatttggcggtcaatacgtaccggaaacgattatgaatgca
ttgatagaacttgaagacgaattttacaaggcaataaatgataaagattttattgatgaa
tacaaatattatttaagagaatattctggaaggcctacaccgttgtattttgcaagaaac
ttaactgaaagattgggtggcgcaaaaatatatttgaaaagagaagatttaaaccacact
ggcgctcataaaataaacaacgttttagggcaaatattgctggctaaaagaatgggcaaa
aggaaagtcatcgctgaaacaggtgcaggacaacacggtgtagcgactgcaacaggcgct
gcgatgtttgacatggaatgtgagatatttatgggagaagaagacataaaaagacagtca
ttgaacgtatttagaatgaagttattgggtgcaaaagttactcctgttaagacggggact
ggcacattgaaagatgctgttaacgaagcgatacgcaattgggtcacgaatatcgatgat
acattttatgtgatgggctctgttgtaggaccgcatccatatccgataatggttagagat
tttcagagggtgatcggcgacgagacgagagaacaaattttaagcaaagaaaagagattg
cctgattatattgttgcatgtgtgggcggtggcagcaattctatgggtatattttaccct
tttataaacgattcatcagttaaacttataggggtagaagctgcaggccttggaatagat
acaaataaacatgccgctacaatggcaaaaggaagcattggcgtcctccatggcatgatg
acgtatctgcttcaagatgatgaaggacagataatgcctgtgtactcaatatcagcagga
cttgattatcctggtgtagggcctgaacatgcttatttgagggataccggcagagcacaa
tatgtgtatgcaactgatgaagaagctttgtcagcttttatggatttatctcaaattgaa
ggaatcataccggcattggaaagtgcccatgctgttgcctatgcaatgaaacttgctcca
agtcttagcaaagatgatattatagttgtaaatttatcaggcagaggagacaaagacgtc
aatacagtagcgaatgttttggaggttgagctatga

DBGET integrated database retrieval system