KEGG   Thermoanaerobacterium saccharolyticum: Tsac_2297Help
Entry
Tsac_2297         CDS       T02137                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
tsh  Thermoanaerobacterium saccharolyticum
Pathway
tsh00010  Glycolysis / Gluconeogenesis
tsh00052  Galactose metabolism
tsh00500  Starch and sucrose metabolism
tsh00520  Amino sugar and nucleotide sugar metabolism
tsh00521  Streptomycin biosynthesis
tsh01100  Metabolic pathways
tsh01110  Biosynthesis of secondary metabolites
tsh01120  Microbial metabolism in diverse environments
tsh01130  Biosynthesis of antibiotics
tsh01200  Carbon metabolism
Module
tsh_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tsh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tsac_2297
   00052 Galactose metabolism
    Tsac_2297
   00500 Starch and sucrose metabolism
    Tsac_2297
   00520 Amino sugar and nucleotide sugar metabolism
    Tsac_2297
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Tsac_2297
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Tsac_2297
Enzymes [BR:tsh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Tsac_2297
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Pico_P2B BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: AFK87301
UniProt: I3VXQ6
Position
complement(2357867..2358754)
Genome map
AA seq 295 aa AA seqDB search
MKKVIGIDIGGTKILGGVIGSNGDLIKFKETSTDANLGRDHILKKLFSVLDDLFDTDIEG
IGIGSAGRINFNTGEVIYATDNLPGWTGINLKEIISQKYKTKTIVENDVNAAIIGENWLG
SAKSFKDVLMITLGTGVGGAIILDGKLIRGSHFSAAEIGHTILYPGGKRCNCGQNGCVEQ
YISGTAIYKRYNEIVGSNLVSSAKDVFNLYMKNDKISKLVVDEFVKSLSLLIFNIRNFID
PEIIILGGGVTNSKDLWWEYLKSQIKCDLNISIAGLNNFSTVYGAAKLILNEGVV
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagttattggtatagatattggtggtacaaaaattttaggtggggttattggt
tcaaatggagatttaattaaatttaaagagacttcaacagatgctaatttaggcagagat
cacatattgaaaaaattattcagtgtattagatgatttatttgatactgatatagaagga
attggcattggttcagccggtagaattaattttaatacaggtgaagttatttatgctacg
gataatttaccaggttggactggcataaatttaaaagaaattatttctcaaaaatataag
acaaaaacaatagttgaaaatgatgttaatgcggcaattattggtgaaaattggctaggc
tctgctaaaagttttaaagacgttttaatgataactttagggacaggtgttgggggtgca
ataatactagatggtaaattgataagaggaagtcatttcagcgcagcggaaattggccat
actattttgtatcctggtggcaaaagatgcaactgtgggcaaaatggttgcgttgaacaa
tatatatcgggtactgcaatatataaaagatacaatgaaatagtgggttctaatttggtg
agtagtgcgaaagatgttttcaatttgtatatgaaaaacgataaaatatcaaagttagtt
gtggatgaatttgtaaaatcgctctcattattaatttttaacataagaaattttattgat
cctgaaataatcattctcggaggtggtgtaacaaattcaaaagatctgtggtgggaatat
ttaaaatcgcaaataaaatgtgatttaaatatttctatcgcaggacttaataacttttcg
acagtctatggtgccgcaaaattaattttaaatgagggggttgtttaa

DBGET integrated database retrieval system