KEGG   Thermoanaerobacterium saccharolyticum: Tsac_2312Help
Entry
Tsac_2312         CDS       T02137                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tsh  Thermoanaerobacterium saccharolyticum
Pathway
tsh00010  Glycolysis / Gluconeogenesis
tsh00051  Fructose and mannose metabolism
tsh01100  Metabolic pathways
tsh01110  Biosynthesis of secondary metabolites
tsh01120  Microbial metabolism in diverse environments
tsh01130  Biosynthesis of antibiotics
tsh01200  Carbon metabolism
tsh01230  Biosynthesis of amino acids
Module
tsh_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
tsh_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:tsh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tsac_2312
   00051 Fructose and mannose metabolism
    Tsac_2312
   00562 Inositol phosphate metabolism
    Tsac_2312
Enzymes [BR:tsh01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Tsac_2312
Exosome [BR:tsh04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Tsac_2312
  Exosomal proteins of bladder cancer cells
   Tsac_2312
  Exosomal proteins of melanoma cells
   Tsac_2312
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM PEP_hydrolase NMO ThiG
Motif
Other DBs
NCBI-ProteinID: AFK87314
UniProt: I3VXR9
Position
complement(2371582..2372289)
Genome map
AA seq 235 aa AA seqDB search
MMKGIRVPFFVVNPKSYLYGEESLRLAFAADKFAEEYDVDIFFTAPFADLYYIKSNTKNI
KITAQHMDPLLPGRGMGYVLPESIKSSGAEAVFLNHAEHSLKLSDLVKTIKRAKDLELIT
IVCADSVEEATAIAMLEPDILLCEPTDLIGTGKTSGYEYIRETTRKIKDINSNILVMQAA
GISSGEDVYQTIINGADGTGATSGIINAPDRIKMLEEMIQAIVKAKNELGYGRRP
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagggtataagagttccattttttgtagtcaatcccaagtcatatctttacggt
gaagaaagtttgcgattggcatttgctgcagacaagtttgctgaagaatatgatgttgat
atattttttactgcgccgtttgcagatttatattacattaaatctaatacaaaaaacatc
aagattacagcacaacatatggatccattactacctggacgagggatgggctatgtactg
cctgaatccataaaatcatcgggtgctgaagcagtatttttaaatcatgctgagcattca
ttaaaactatcggatttggtcaaaacgataaaaagagcgaaagatttagaacttattaca
attgtatgtgctgattctgtagaagaagctacagctatagctatgttggaacctgacata
ctattgtgtgaaccaactgatttaattggtacagggaaaaccagcggttatgagtatata
agagaaactacgagaaagataaaagatataaatagcaatatcttagtcatgcaggcagct
ggaataagttctggagaagatgtttatcagacgataataaatggtgccgatgggacagga
gcgacaagcggcataattaatgcaccagatagaataaaaatgttagaagaaatgatacag
gcaattgtaaaggcaaaaaacgaattgggttacggaaggaggccttag

DBGET integrated database retrieval system