KEGG   Thermoanaerobacterium saccharolyticum: Tsac_2684Help
Entry
Tsac_2684         CDS       T02137                                 

Definition
RecD/TraA family helicase
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
tsh  Thermoanaerobacterium saccharolyticum
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:tsh03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2723575..2725791)
Genome map
AA seq 738 aa AA seqDB search
MVEIIGTVEEIIFKNEQSGYAVLELNSKKDTITVVGYMPYVGIGETLKVEGEWMVHPDYG
EQVKVSKYETIAPSTLYGMERFLSSGLIRGIGPVMAKKIVSKFGVDSINVIESHPEKLLD
IPGIGEERVKMISESYEQQKTLRDVMVFLQGYGISTTNAIKIYRQYGDDSIDLIKQNPYR
LSDEIFGIGFRTADKIARAMGVDTHSGYRISSGTKYVLMQYASNGHTYVPLELLLKETAR
LLDVSEEEVYDSLVLLVQSEKVKFETFEDGSHGVYYIPYFVAENNTADKILNMTLTDVKP
EDIDIENEIWKIESDMGIHLADNQRVAVLESVKNSILVITGGPGTGKTTIINFIIRLFKK
FKKSVALAAPTGRAAKRMTEATGFEAKTIHRLLEYSYTEEEGRGFGKDDKNPLTEDVIIV
DEASMIDILLMNALLKAIPLSSRLILVGDVDQLPSVGAGNVLRDIIDSGLVKVIRLNKIY
RQGKESLIVVNAHKINNGEYPVLNDKENDFFFINASSQDEILNTILDLCKRRLPEAYGFN
PFTDIQVLSPMRKGLIGMINLNNELQKCLNPSKNGLDERQMKDFTFRVGDKVMQIKNNYK
MKWTKGDEKGEGVFNGDMGIIESIDNDSQELTVLFDDDKRVVYDFADVDELSLSYCVTVH
KSQGSEFPAVIMPMSFGPPMLLTRNLLYTAVTRAKKLVVIVGQEKYLKNMIDNNLISKRY
SGLLPKLRKVLKFMVEES
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atggttgaaataataggtactgttgaggaaataatttttaaaaacgaacaaagtgggtat
gctgtattagaacttaattcaaagaaggatactattacagtagtaggatatatgccttat
gttggaataggtgaaacgcttaaagttgaaggcgagtggatggtgcatcctgactacggg
gaacaggtgaaggtttcaaagtacgagacaatagcgccgtcaacattgtatggcatggaa
agatttttgtcgtctgggctcataagaggtataggacctgtcatggcaaaaaaaatcgtc
tcaaaattcggcgtggattctataaatgtcatagaatctcatccggaaaagttattggat
atacctgggataggcgaagaaagggtaaagatgatatcagaatcttatgagcagcagaag
acattgagagatgtgatggtttttttacaaggctatggcatttctactaccaatgcgata
aaaatatacaggcagtacggtgatgattctatagatcttataaagcaaaatccgtacaga
ctatcggatgaaattttcggaattggctttagaacggctgataagatagctcgagcaatg
ggtgttgatacgcattctggatacaggatttcatctggcacaaagtacgtgttgatgcag
tacgcatcaaatggccatacgtatgtgccgctggaacttttgcttaaagaaaccgcgaga
cttcttgatgtatcagaagaagaagtttatgattcgctggttcttttggtacaaagcgaa
aaagtgaaatttgagacatttgaggatggctcacatggtgtatattacataccgtatttt
gtggctgaaaacaacactgcagataagattttaaacatgacgctgacagatgtaaagcct
gaggatatcgacattgaaaatgaaatatggaagatagagtcagatatgggaattcatctt
gcagataatcagcgcgtcgcagttttagaatctgttaaaaactcaattctcgtcataaca
ggtggtcctggaacaggaaagactacgataataaacttcataataaggctttttaaaaaa
ttcaagaaatcagtagcattagctgcaccaacggggcgagctgcaaagaggatgactgaa
gctacaggatttgaagcaaagacgatacaccgccttttggagtattcatacacagaagaa
gaaggacgaggttttggcaaggatgacaagaatccattgactgaagatgtcataatagtg
gacgaggcttcgatgatagacatattgcttatgaatgctctccttaaagctatcccatta
agctcaaggcttatacttgtaggtgatgttgatcaacttccatccgttggagctggcaac
gtgcttagagatataatagatagcggcttagtaaaagtaataaggcttaataagatatac
aggcagggaaaagaaagcttaatagtggtaaatgcccataagataaacaatggagagtat
cctgttttaaatgataaagaaaatgattttttcttcatcaatgcttcgtcgcaagatgaa
attttaaatactatattagacttatgcaaaaggcggttgcctgaagcgtatggattcaac
ccttttacggatatccaggttttaagccctatgagaaaaggtttgataggcatgataaat
ttaaacaatgaactgcaaaagtgcttaaatccatcaaaaaatgggttggatgaaagacag
atgaaagattttactttcagagtgggagataaagtgatgcaaataaaaaacaactacaag
atgaagtggacaaaaggtgatgaaaaaggtgaaggcgtctttaatggcgatatgggtatc
atagagtctatcgataatgattcacaggagcttaccgtattatttgatgatgacaaaagg
gttgtttacgattttgcagatgtagatgagttaagcctttcgtattgtgtgactgttcac
aaaagccaaggaagtgaatttccggctgtcataatgcctatgagctttggaccgcctatg
cttctcaccagaaaccttttgtacactgctgtaacgagggctaaaaaacttgtggtaata
gtgggccaagaaaaatacttaaaaaacatgatagataataatcttatatcaaagaggtat
tcagggctcttgcctaaacttaggaaagtccttaaattcatggtggaagaaagttga

DBGET integrated database retrieval system