KEGG   Thermococcus sibiricus: TSIB_0175Help
Entry
TSIB_0175         CDS       T00928                                 

Definition
peptidase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
tsi  Thermococcus sibiricus
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:tsi01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:tsi00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
172522..173865
Genome map
AA seq 447 aa AA seqDB search
MKILMVRTMKILELLSDLVEFETVNDPAKGIKPSKDCPKFVMDILSSWGIETELIEKDGY
YAVYGELGEGKPKILFMAHFDVVPVNREEWNTEPFKLVIKGNKAYGRGSADDKGNVASVM
LAIKELSKMDLEGKVLFAVTGDEEIGGVLAMHIAEKLRDEGKMPEYMINADGVGMKPIIR
RRKGFGVTIRMPSEKVKLKGTLKEQKFRINTPIVETRHAAYFLPGVDTHPMIAVSHFLRN
SNVAVVSLEGKFLKGNIVPSEVTLKYLEVGDGEEIEVDLGLTRLLKAIIPLVRAPIKTEK
YSDYGVSITPNLYSYQGNKHVLRLDIRAMSYSQEAIETTLKEIIRFNIPNAEITIRSNEK
AGYLFTPPDEGIVTTMLKILEGFDQKAEPVEGPGAADSRFFTPYGVKAIDFGPKGGNIHG
PNEYVDIESLKVLPDVYKEVALRLIKG
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcttaatggtgaggactatgaaaatattggaacttctctcagaccttgtggag
tttgagacggtaaacgacccagcaaaagggattaagccctctaaagactgccccaaattt
gtaatggacatcctctcttcatggggcattgagactgagttgatcgagaaggatggatac
tatgccgtttacggtgaactaggggagggaaaaccaaaaatcctttttatggcccatttt
gacgttgtacccgtaaacagggaggaatggaatacagagccatttaaattagtgataaag
ggcaataaggcatatgggagaggaagtgccgatgataagggaaatgttgcctcagtaatg
ctggctattaaggaattatcgaagatggatcttgagggaaaagttctctttgcagttacg
ggggatgaagaaataggtggggtcttagccatgcacattgcggagaaacttagagatgag
ggtaaaatgcccgaatatatgataaacgccgatggggttggcatgaaaccaattattcga
agaagaaaaggctttggagttacaataaggatgccttcagaaaaagttaaacttaaaggg
actttaaaggaacaaaagtttagaataaacactcctatagttgaaacgaggcatgctgct
tatttccttccgggggtcgacactcatccaatgatagctgtttcccatttcctaaggaat
agcaatgttgcagttgtctctctcgaaggcaaattcttaaaggggaacattgtaccgagt
gaagtgacccttaaatatcttgaagtgggtgatggggaagagattgaggtagatcttgga
ttgacaaggcttttgaaagctataatacctcttgtgagggccccaataaagactgaaaag
tacagtgattatggtgtctccataacgcctaacttatattcttatcaggggaataaacac
gttctaaggttggatataagggcgatgagttattctcaggaggctattgaaacgactttg
aaagagattatcagattcaacattcctaatgcagaaatcacgattagaagtaatgaaaaa
gctggttatctttttacacctccagatgagggaatagtgacaacaatgctaaaaatactc
gaggggtttgaccagaaagcggagcctgtagaagggcctggagcggctgattcaagattt
ttcacaccttatggagtcaaggcgatagattttgggcccaaaggcgggaatattcatggg
cctaatgaatatgtggacattgaatcccttaaagtgttgcctgatgtatacaaagaggtt
gcattgagacttattaagggttaa

DBGET integrated database retrieval system