KEGG   Thermococcus sibiricus: TSIB_0324Help
Entry
TSIB_0324         CDS       T00928                                 

Definition
Beta-galactosidase (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
tsi  Thermococcus sibiricus
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tsi00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    TSIB_0324
  Lipid metabolism
   00600 Sphingolipid metabolism
    TSIB_0324
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    TSIB_0324
Enzymes [BR:tsi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     TSIB_0324
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(313628..315133)
Genome map
AA seq 501 aa AA seqDB search
MEKEFLWGVAQSGFQFEMGDRFNRHLDIRSDWWKWVRDPTNLKKGLVSGDLPEEGINNYE
LYPIDHLLAKKLGANAYSLNLEWSRIFPCATYGIDVDYELDSNGLIKEVKITKEVLEELN
NIANIEEVEHYMSVLSNLKKMGFKVFITIVHYTHPLWLHDPIESRETNLKNERNGWVNQR
SIIEFTKFAAYLAYKFGHLVDMWTTFNEPMVMVELGYLAPYSGFPPGVISPENAKKAIIN
IINAHARAYEAIKNFSKAPVGIIANNVGTSYPKDPNNPKDVKAAEMVDFFHSGLLLKALT
EGELNAEFDMETMLKVPHLKRLDWIGMTYYSREVITHSEPKFKEIPITAFKGVPGYGYSC
PPNESSLDGHPVSDIGWEVYPEGIYNSIKAASSYGKPIYIMENGIADSKDLLRPYFIASH
IDYIEKAIEEGFDVRGYFHWALTDNYEWAMGFRMRFGLYVVDMITKERIPRKESVGVYRE
IIENDGITDRIRKEYLRGDMI
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaagagtttctttggggagttgctcagtccggtttccagttcgaaatgggggat
agattcaatagacacctagacataagaagtgattggtggaaatgggttagggatcccacc
aatctaaaaaaaggacttgtaagtggagatttgcccgaagaaggtataaataactacgaa
ctttatcctatcgatcatctccttgcaaagaagcttggggctaatgcctactccctcaac
ctagaatggagcagaatattcccatgtgcaacctatggaattgacgtcgactacgagctt
gatagtaacgggctgattaaagaggttaaaatcaccaaagaagtccttgaagaacttaac
aatattgcaaacattgaggaagttgagcactacatgagtgttctctcaaacctgaagaag
atgggattcaaagtgtttataaccattgtccattatacacatcctctatggctacatgat
ccaatagaatctagggaaaccaacctaaaaaacgaaagaaacggatgggtaaaccaacgc
tccataatagagttcacaaagtttgcagcttaccttgcctacaagtttgggcatcttgtg
gacatgtggacaacattcaacgagcctatggtaatggttgagcttggttacctagctccg
tattcgggatttcccccgggagtcataagtccagaaaacgcaaagaaggcaattattaac
ataataaacgctcacgcaagggcctatgaagcaataaagaatttctcaaaagcgcctgtt
ggaataatcgcgaacaacgtgggaacatcttaccccaaagaccctaacaaccccaaggac
gttaaagcagctgaaatggtcgacttcttccacagtggacttctgcttaaagcactgacc
gagggagagctaaatgctgaatttgatatggaaacaatgttgaaggtaccccatttaaag
cggctcgactggataggcatgacatactattcgagggaggttattacccattcagaacct
aagttcaaggaaatcccaatcacggctttcaagggagtacctggctatggttactcttgc
ccaccaaatgaatcatccttagatggacaccccgtaagcgacattggatgggaggtttat
ccagaaggaatatacaacagcataaaggctgcatcgtcctatggaaagcccatatatata
atggaaaacgggatcgccgattccaaagatcttttgagaccctacttcatagcatcgcat
atagattacatagaaaaggccatcgaagagggctttgatgtccggggctacttccactgg
gctctgacggacaattacgagtgggccatgggcttcaggatgagatttggtctttatgta
gtcgatatgataacaaaagagagaattcctcggaaagaaagtgttggtgtgtacagagag
atcatagagaatgatggcataacagataggattagaaaagaatacctcaggggtgatatg
atatga

DBGET integrated database retrieval system