KEGG   Thermococcus sibiricus: TSIB_0324Help
Entry
TSIB_0324         CDS       T00928                                 

Definition
Beta-galactosidase (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
tsi  Thermococcus sibiricus
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:tsi00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:tsi00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(313628..315133)
Genome map
AA seq 501 aa AA seqDB search
MEKEFLWGVAQSGFQFEMGDRFNRHLDIRSDWWKWVRDPTNLKKGLVSGDLPEEGINNYE
LYPIDHLLAKKLGANAYSLNLEWSRIFPCATYGIDVDYELDSNGLIKEVKITKEVLEELN
NIANIEEVEHYMSVLSNLKKMGFKVFITIVHYTHPLWLHDPIESRETNLKNERNGWVNQR
SIIEFTKFAAYLAYKFGHLVDMWTTFNEPMVMVELGYLAPYSGFPPGVISPENAKKAIIN
IINAHARAYEAIKNFSKAPVGIIANNVGTSYPKDPNNPKDVKAAEMVDFFHSGLLLKALT
EGELNAEFDMETMLKVPHLKRLDWIGMTYYSREVITHSEPKFKEIPITAFKGVPGYGYSC
PPNESSLDGHPVSDIGWEVYPEGIYNSIKAASSYGKPIYIMENGIADSKDLLRPYFIASH
IDYIEKAIEEGFDVRGYFHWALTDNYEWAMGFRMRFGLYVVDMITKERIPRKESVGVYRE
IIENDGITDRIRKEYLRGDMI
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaagagtttctttggggagttgctcagtccggtttccagttcgaaatgggggat
agattcaatagacacctagacataagaagtgattggtggaaatgggttagggatcccacc
aatctaaaaaaaggacttgtaagtggagatttgcccgaagaaggtataaataactacgaa
ctttatcctatcgatcatctccttgcaaagaagcttggggctaatgcctactccctcaac
ctagaatggagcagaatattcccatgtgcaacctatggaattgacgtcgactacgagctt
gatagtaacgggctgattaaagaggttaaaatcaccaaagaagtccttgaagaacttaac
aatattgcaaacattgaggaagttgagcactacatgagtgttctctcaaacctgaagaag
atgggattcaaagtgtttataaccattgtccattatacacatcctctatggctacatgat
ccaatagaatctagggaaaccaacctaaaaaacgaaagaaacggatgggtaaaccaacgc
tccataatagagttcacaaagtttgcagcttaccttgcctacaagtttgggcatcttgtg
gacatgtggacaacattcaacgagcctatggtaatggttgagcttggttacctagctccg
tattcgggatttcccccgggagtcataagtccagaaaacgcaaagaaggcaattattaac
ataataaacgctcacgcaagggcctatgaagcaataaagaatttctcaaaagcgcctgtt
ggaataatcgcgaacaacgtgggaacatcttaccccaaagaccctaacaaccccaaggac
gttaaagcagctgaaatggtcgacttcttccacagtggacttctgcttaaagcactgacc
gagggagagctaaatgctgaatttgatatggaaacaatgttgaaggtaccccatttaaag
cggctcgactggataggcatgacatactattcgagggaggttattacccattcagaacct
aagttcaaggaaatcccaatcacggctttcaagggagtacctggctatggttactcttgc
ccaccaaatgaatcatccttagatggacaccccgtaagcgacattggatgggaggtttat
ccagaaggaatatacaacagcataaaggctgcatcgtcctatggaaagcccatatatata
atggaaaacgggatcgccgattccaaagatcttttgagaccctacttcatagcatcgcat
atagattacatagaaaaggccatcgaagagggctttgatgtccggggctacttccactgg
gctctgacggacaattacgagtgggccatgggcttcaggatgagatttggtctttatgta
gtcgatatgataacaaaagagagaattcctcggaaagaaagtgttggtgtgtacagagag
atcatagagaatgatggcataacagataggattagaaaagaatacctcaggggtgatatg
atatga

DBGET integrated database retrieval system