KEGG   Thermococcus sibiricus: TSIB_0476Help
Entry
TSIB_0476         CDS       T00928                                 

Definition
Tungsten-containing formaldehyde:ferredoxin oxidoreductase (FOR) (EC:1.2.7.5)
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
tsi  Thermococcus sibiricus
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:tsi01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:tsi00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
453113..454978
Genome map
AA seq 621 aa AA seqDB search
MKGWWGRILRVDLTNNKVWVQEYSEEVAKNFIGGRGLAAWILWNEAKNVDPLGPDNKLIF
ASGPFNGLPTPSGGKMVIAAKSPITGGYGDGNLGTMATVHLRKAGYDALVVEGKAKKPVY
IYIEDDNVSILSAEGLWGKTTFETEKELKEVHGKNVGVLSIGPGGENLVKYAVVISQEGR
AAGRPGMGAVMGSKKLKAVVVKGTKEIPVADKEKLRELSQEAYNAILNSPGYPFWHRQGT
MAALEWTNENSALPTRNFSDGSFEFARSIDGFTMEGMKVKQRGCPYCNMPCGNVVLDADG
QESELDYENVALLGSNLGLGKLNEVSVLNRIADEMGLDTISLGVSISYVMEAKEKGLIKD
ENAPEFGDFKKAKQLALDIAYRRGELGNLAAEGVKGMSEKLGAKDFAMHVKGLEVSGYNC
FIYPAMALAYGTSAIGAHHKEAWVIAWEIGTAPIEGEKAQKVEYKISYDPEKAAKVIELQ
RLRGGLFEMLTACRLPWVEVGLSLDYYPKLIEAITGVKYTWDDLYKAADRVYALMRAYWV
REYNSNWSREMDYPPERWFKEGLKSGPYKGQHLDKEKYDVLLNEYYKLRSWDERGIPKKE
TLKDLGLEFVIPELEKVTKLE
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggttggtggggaaggatacttagagttgatttaacgaacaacaaagtatgggtg
caagaatactctgaagaggtcgcaaagaactttattggtggtagaggtttagctgcatgg
attctttggaatgaagccaaaaacgtagatcctctcggtcctgataacaaattgatcttt
gcaagcggtccgtttaacggtcttccaaccccaagcggtggaaaaatggttatcgctgct
aagagcccaataacaggtggttacggcgatggtaaccttggaacaatggccactgtgcac
ctgagaaaagctggttatgatgctcttgttgttgaaggaaaggccaaaaagccagtctac
atctatattgaggatgataacgttagtatcttaagtgctgagggcctttggggcaagact
acctttgaaactgagaaagaacttaaagaggtccatggtaaaaatgttggtgttctcagc
ataggtcctggtggagagaatcttgtcaaatacgcagtagtaatttctcaagaaggaagg
gccgctggaaggcctggtatgggtgcagtgatgggaagtaagaagttaaaggcagttgtg
gtaaagggtaccaaagaaattcctgttgctgataaggagaagcttagggagctttcacaa
gaggcctacaatgcaattcttaactcgccaggttatccattctggcatagacaaggaaca
atggctgcacttgaatggaccaatgaaaactcggctcttccaacaagaaacttcagtgac
ggtagttttgagttcgctcgttctattgatggttttacaatggaaggtatgaaagttaag
caaagaggctgtccatactgtaacatgccatgtggaaacgtggttcttgatgcagatggc
caagagagtgagcttgactatgaaaatgttgctctattaggttcaaaccttggacttggg
aagctcaatgaagtctcagtccttaatagaattgccgacgagatgggccttgatacaata
tcccttggagtatcgatctcttatgtgatggaagccaaagagaagggtctcataaaagat
gagaatgctcccgaatttggcgacttcaagaaagccaagcagcttgccttggatatagct
tacagaaggggagagcttggaaaccttgctgctgaaggtgtcaaaggtatgagtgaaaaa
ctcggtgctaaggacttcgcaatgcacgtaaaaggtttagaagtaagcggttacaactgt
ttcatctatccagcaatggctttggcatatggaacaagtgccattggagctcaccacaag
gaagcatgggtcatcgcatgggaaattggaacagctccaattgagggtgaaaaggctcag
aaggttgaatataaaatctcttatgacccagagaaggctgcaaaggtcattgaattgcag
aggctcagaggtggtctcttcgagatgctcacggcatgtaggcttccatgggttgaagtg
ggactcagcttggactactatcccaagcttattgaggctatcacaggtgttaagtataca
tgggacgacttatacaaagcagctgatagagtttatgccctcatgagggcctactgggta
agagaatacaatagcaactggagcagggagatggactacccaccagagagatggttcaaa
gaaggccttaagagtggaccttataagggacagcaccttgataaggagaaatatgacgtg
ctactcaacgaatactacaagctcaggagctgggatgagagaggtattccaaagaaggag
accctcaaagaccttggccttgaattcgttattccagagcttgagaaggttacaaagctc
gagtga

DBGET integrated database retrieval system