KEGG   Thermococcus sibiricus: TSIB_0529Help
Entry
TSIB_0529         CDS       T00928                                 

Definition
Acetyl-CoA synthetase I (ACSI, ADP-forming), subunit alpha (EC:6.2.1.13)
Orthology
K01905  
acetyl-CoA synthetase (ADP-forming) [EC:6.2.1.13]
Organism
tsi  Thermococcus sibiricus
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tsi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TSIB_0529
   00620 Pyruvate metabolism
    TSIB_0529
   00640 Propanoate metabolism
    TSIB_0529
Enzymes [BR:tsi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.13  acetate---CoA ligase (ADP-forming)
     TSIB_0529
Lipid biosynthesis proteins [BR:tsi01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   TSIB_0529
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
494982..496379
Genome map
AA seq 465 aa AA seqDB search
MEEMSIEALFKPRSVAVVGASGKPGKIGYAIMKNLIEYGYEGKIYAVNVKGGEIEVSGRK
FKVYESILDVPDEVDMAVVVVPAKFVSQVVEECGKKGVKVLPIISSGFGELGEEGKKVEE
QLVETAHKYGMRILGPNIFGIVYTPAKLNATFGPTDVLPGKLALVSQSGALGIALMGWTI
LEKVGLSAVVSIGNKSDLDDADMLEYFENDENTGAILIYMEGVKDGRKFMETAKRVSMKK
PIIIIKAGRSERGAKAAASHTGSLAGADSIYTAAFKQSGVLRALTIGEAFDWARTLSNLP
EPEGENVVIITNGGGIGVMATDAAEEEDLKLYDNLEELKVFANHMPPFGSYKNPVDLTGM
ADAKAYEGAVRDALANPNMDAVAVLYCQTAVLDPRDLAKIVIEEYEASGRKKPLVVAIVG
GIEAKEAIDLLNERGIPAYPEPERAIKSLSALYRWHNWKMKHKKE
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
gtggaggaaatgagcatagaagcacttttcaaacctaggagtgtagctgttgtaggtgct
tccggaaaacctggaaagataggatatgcaattatgaagaatctcattgagtacggctat
gagggcaaaatatacgctgttaatgtcaaaggtggagaaatagaggttagtggaaggaag
ttcaaggtttacgagagtattcttgatgtccccgatgaagtggacatggctgttgtagtt
gttcctgctaagtttgtctcacaagttgtggaagagtgtggaaagaaaggagtcaaagtt
cttccaattatcagttcagggtttggagagcttggagaagaaggcaaaaaagttgaagag
cagttagttgagacagctcacaagtatggaatgaggattcttggacctaatatctttggt
attgtttatactccagcaaagctcaatgccacatttggtccaactgatgttctgccagga
aagctcgctttagtatcccagagtggtgcccttggaatagctcttatgggatggacaatt
ctcgaaaaagtcggcctctcagctgtagttagcattggaaacaagagcgatttagatgat
gctgatatgcttgagtactttgagaacgatgagaacacaggtgctatcttaatttacatg
gaaggtgttaaagacggaagaaagttcatggagacagcaaaaagggtttcaatgaagaag
cctatcatcatcataaaggcaggcaggagtgagagaggtgcaaaggcagctgcatcccac
actggttcacttgcgggcgctgacagtatttatacagctgcattcaagcaaagtggtgtt
ttaagagccttaaccattggtgaagctttcgattgggcgagaactctgagcaatcttcca
gaaccagaaggagaaaacgttgtcataatcacaaatggcggtggaataggcgtcatggct
acagatgctgcagaggaagaggatctaaaactctatgacaatttggaggaacttaaggtc
tttgcaaaccacatgccgccttttggttcgtataagaatccagttgatttgacaggtatg
gcagatgctaaagcctatgaaggggcagttagggacgcacttgcaaatccaaacatggat
gcagtagcagttctctactgtcaaacagctgttcttgatccaagagaccttgcaaaaata
gttattgaagaatatgaagcaagtggaaggaagaaaccactcgtggttgccatagttggt
ggaattgaggctaaagaagctattgatctgcttaatgaaaggggcattccagcatatcca
gaaccagaaagagcaattaaatctctatcagctctctacagatggcacaactggaaaatg
aaacataagaaagagtga

DBGET integrated database retrieval system