KEGG   Thermococcus sibiricus: TSIB_0666Help
Entry
TSIB_0666         CDS       T00928                                 

Definition
Dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
tsi  Thermococcus sibiricus
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:tsi00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(618327..619151)
Genome map
AA seq 274 aa AA seqDB search
MKFAGISLEEPRIMGVINVSPESFFKGSIRQREDEIIETALKMLEDGASFIDIGAKSTAP
YLENQIPVEEEIRRAVWTLSILRDNVDVPISIDTTNAKVAEEAIKVGADIINDISGLKGD
PKMVEVAREYDVPLILCAHKDVKDFSDPVHEVINALQESLQIAYKNNIEKEKIAIDPAIG
FLRPKYPPWYEWDSKVIANLNLLKMFGLPILVGVSRKSFIGAITGRRDPTERLAGSLGAT
AIAVWNGANIIRTHDVRETLDAIKITHFIKRFRE
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcgctggcatcagtctagaagagcctagaatcatgggagtaattaatgtttcc
ccggaaagcttctttaaaggtagcatcaggcaaagagaggatgaaataatagaaacagcc
ctaaagatgctcgaagatggtgcgtctttcatagatattggagccaaatctaccgcccca
tatttggaaaatcaaatacctgtggaagaagaaataaggagagcggtttggacattaagc
attcttagagacaacgttgatgttcccataagtattgacaccacaaacgcaaaagttgcg
gaagaggccataaaagttggcgcagatataataaatgacataagcggccttaaaggagac
ccaaagatggtagaagttgccagagaatacgatgtccctcttatcctttgcgctcataag
gatgttaaagatttcagtgacccagttcatgaagtaattaacgcccttcaagagagtcta
caaatagcctacaaaaacaacattgagaaagagaaaattgccattgacccagcaattgga
tttttaaggcccaaatatcccccatggtacgagtgggattcaaaagttattgccaatcta
aatttgcttaagatgtttggccttccaatccttgttggagtctcaaggaaatcatttata
ggtgcaataacaggcagaagagatccaacggaaagactagccggaagcttgggagcaacc
gctatagcagtctggaatggagcaaatataataagaacccatgacgttagggagaccctt
gacgcgattaagattacacactttataaaaagatttagagagtaa

DBGET integrated database retrieval system