KEGG   Thermococcus sibiricus: TSIB_0666Help
Entry
TSIB_0666         CDS       T00928                                 

Definition
(GenBank) Dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
tsi  Thermococcus sibiricus
Pathway
tsi00790  Folate biosynthesis
tsi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tsi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    TSIB_0666
Enzymes [BR:tsi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     TSIB_0666
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind CdhD
Motif
Other DBs
NCBI-ProteinID: ACS89731
UniProt: C6A286
Position
complement(618327..619151)
Genome map
AA seq 274 aa AA seqDB search
MKFAGISLEEPRIMGVINVSPESFFKGSIRQREDEIIETALKMLEDGASFIDIGAKSTAP
YLENQIPVEEEIRRAVWTLSILRDNVDVPISIDTTNAKVAEEAIKVGADIINDISGLKGD
PKMVEVAREYDVPLILCAHKDVKDFSDPVHEVINALQESLQIAYKNNIEKEKIAIDPAIG
FLRPKYPPWYEWDSKVIANLNLLKMFGLPILVGVSRKSFIGAITGRRDPTERLAGSLGAT
AIAVWNGANIIRTHDVRETLDAIKITHFIKRFRE
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcgctggcatcagtctagaagagcctagaatcatgggagtaattaatgtttcc
ccggaaagcttctttaaaggtagcatcaggcaaagagaggatgaaataatagaaacagcc
ctaaagatgctcgaagatggtgcgtctttcatagatattggagccaaatctaccgcccca
tatttggaaaatcaaatacctgtggaagaagaaataaggagagcggtttggacattaagc
attcttagagacaacgttgatgttcccataagtattgacaccacaaacgcaaaagttgcg
gaagaggccataaaagttggcgcagatataataaatgacataagcggccttaaaggagac
ccaaagatggtagaagttgccagagaatacgatgtccctcttatcctttgcgctcataag
gatgttaaagatttcagtgacccagttcatgaagtaattaacgcccttcaagagagtcta
caaatagcctacaaaaacaacattgagaaagagaaaattgccattgacccagcaattgga
tttttaaggcccaaatatcccccatggtacgagtgggattcaaaagttattgccaatcta
aatttgcttaagatgtttggccttccaatccttgttggagtctcaaggaaatcatttata
ggtgcaataacaggcagaagagatccaacggaaagactagccggaagcttgggagcaacc
gctatagcagtctggaatggagcaaatataataagaacccatgacgttagggagaccctt
gacgcgattaagattacacactttataaaaagatttagagagtaa

DBGET integrated database retrieval system