KEGG   Thermococcus sibiricus: TSIB_0680Help
Entry
TSIB_0680         CDS       T00928                                 

Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
tsi  Thermococcus sibiricus
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:tsi00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
631752..633263
Genome map
AA seq 503 aa AA seqDB search
MKAKVRILDIETGRFLAFISEEDAKNAKLHPGDLVKIETAKRTIYGDVVISKTINPGEIG
VTKDILRSYTFSEGEVVNLVPSETPESVRYIRRKMNGQKLKKVEIEAIVKDIVNRKLRDI
EISSFVTSLEINGLDMDEIAWLTTAMAETGDMLDIDRKPIMDVHSIGGVPGNKTNILVVP
IVAAAGLTIPKTSSRAITSAAGTADVVEVLAPVTHSLDEIKRIVEKIGACLVWGGALNLA
PADDLTIKAERALSIDPRGLMLASIMSKKYAMGSQYVLIDIPTGEGVKVEKVEDARSLAK
DFIELGKRLGQYVETAITYGGQPIGHTVGPALEAKEALETIIEGKGPGSLVEKATGLAGI
LLEMGGVAPAGMGKKMAKEILESGKAYEKLKEIIEEQGGDPNIKPEDIPIGDKTYTFVAQ
TSGYITRIDNKAITAIARAAGAPEDKGAGIMLHVKVGEKVKERDPLFTVHAESGTRLDQA
IIQARRMEPIRIEGMVLQRIGNI
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcaaaagtgagaatacttgatattgaaactggcaggttcttagcttttattagc
gaggaggatgcaaaaaatgcaaaacttcatcctggagacttggttaagatagaaacagct
aagagaaccatatatggtgatgttgttataagcaaaacgattaatccgggagaaattggg
gttacaaaggatattttgaggtcttatactttttctgaaggagaagtagtaaacttggtt
cctagtgaaactcctgagagtgttcgttatattaggagaaaaatgaatggtcaaaaacta
aaaaaagttgagatagaagcaatagtaaaggatattgtaaatagaaagcttagagacatc
gagataagttcttttgtaacttcacttgagataaacggtcttgatatggatgaaatagca
tggttgaccactgctatggcagaaacaggtgatatgctggatattgacaggaagcccatt
atggatgttcatagtatcggaggcgtacctggaaataaaactaatattcttgtggttccc
attgtggctgctgcagggttaacaattccaaaaacctcctctagggcaataacaagcgca
gctggaacggccgatgtagtggaggtcttggccccagtaacacattctttggatgaaatc
aagagaattgtggagaaaattggggcctgtttagtgtggggaggagctcttaatttagct
cctgctgatgatttgacaataaaggccgaaagagcattgagcattgatccaagaggtctt
atgcttgcaagtataatgtcaaagaagtacgcaatgggctcacaatatgtattgattgac
attccaactggagagggggttaaagttgagaaagtagaagatgctaggtctttggcaaaa
gatttcatagaattaggaaaacgacttggccagtatgtggagactgcaataacatatggt
gggcaaccgattgggcatactgtgggaccagctttagaagctaaggaggctctagagacg
ataattgagggtaaaggaccaggaagtcttgtagaaaaagcgaccgggttagcaggaata
ttgctcgagatgggaggtgtggctccagcaggaatgggcaaaaaaatggctaaagagatt
ctagaaagtggcaaggcttatgaaaagcttaaagagataatagaggagcagggtggggac
cctaatataaagccagaagatattcctataggagataaaacctacacatttgtggcccaa
acttcaggatatataactagaattgacaataaggctataacggcaatagctagagccgcc
ggggcccctgaggataagggggcaggaataatgttacatgtaaaggtaggagaaaaagta
aaagagagagatccactgttcacggtacatgcagaaagtggaacccgactggatcaagct
ataatacaagcaagaaggatggaaccgataagaatagaaggaatggtattacagagaatt
ggaaacatctaa

DBGET integrated database retrieval system