KEGG   Thermococcus sibiricus: TSIB_0680Help
Entry
TSIB_0680         CDS       T00928                                 

Definition
(RefSeq) thymidine phosphorylase (EC:2.4.2.4)
  KO
K18931  
AMP phosphorylase [EC:2.4.2.57]
Organism
tsi  Thermococcus sibiricus
Brite
Enzymes [BR:tsi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.57  AMP phosphorylase
     TSIB_0680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
631752..633263
Genome map
AA seq 503 aa AA seqDB search
MKAKVRILDIETGRFLAFISEEDAKNAKLHPGDLVKIETAKRTIYGDVVISKTINPGEIG
VTKDILRSYTFSEGEVVNLVPSETPESVRYIRRKMNGQKLKKVEIEAIVKDIVNRKLRDI
EISSFVTSLEINGLDMDEIAWLTTAMAETGDMLDIDRKPIMDVHSIGGVPGNKTNILVVP
IVAAAGLTIPKTSSRAITSAAGTADVVEVLAPVTHSLDEIKRIVEKIGACLVWGGALNLA
PADDLTIKAERALSIDPRGLMLASIMSKKYAMGSQYVLIDIPTGEGVKVEKVEDARSLAK
DFIELGKRLGQYVETAITYGGQPIGHTVGPALEAKEALETIIEGKGPGSLVEKATGLAGI
LLEMGGVAPAGMGKKMAKEILESGKAYEKLKEIIEEQGGDPNIKPEDIPIGDKTYTFVAQ
TSGYITRIDNKAITAIARAAGAPEDKGAGIMLHVKVGEKVKERDPLFTVHAESGTRLDQA
IIQARRMEPIRIEGMVLQRIGNI
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcaaaagtgagaatacttgatattgaaactggcaggttcttagcttttattagc
gaggaggatgcaaaaaatgcaaaacttcatcctggagacttggttaagatagaaacagct
aagagaaccatatatggtgatgttgttataagcaaaacgattaatccgggagaaattggg
gttacaaaggatattttgaggtcttatactttttctgaaggagaagtagtaaacttggtt
cctagtgaaactcctgagagtgttcgttatattaggagaaaaatgaatggtcaaaaacta
aaaaaagttgagatagaagcaatagtaaaggatattgtaaatagaaagcttagagacatc
gagataagttcttttgtaacttcacttgagataaacggtcttgatatggatgaaatagca
tggttgaccactgctatggcagaaacaggtgatatgctggatattgacaggaagcccatt
atggatgttcatagtatcggaggcgtacctggaaataaaactaatattcttgtggttccc
attgtggctgctgcagggttaacaattccaaaaacctcctctagggcaataacaagcgca
gctggaacggccgatgtagtggaggtcttggccccagtaacacattctttggatgaaatc
aagagaattgtggagaaaattggggcctgtttagtgtggggaggagctcttaatttagct
cctgctgatgatttgacaataaaggccgaaagagcattgagcattgatccaagaggtctt
atgcttgcaagtataatgtcaaagaagtacgcaatgggctcacaatatgtattgattgac
attccaactggagagggggttaaagttgagaaagtagaagatgctaggtctttggcaaaa
gatttcatagaattaggaaaacgacttggccagtatgtggagactgcaataacatatggt
gggcaaccgattgggcatactgtgggaccagctttagaagctaaggaggctctagagacg
ataattgagggtaaaggaccaggaagtcttgtagaaaaagcgaccgggttagcaggaata
ttgctcgagatgggaggtgtggctccagcaggaatgggcaaaaaaatggctaaagagatt
ctagaaagtggcaaggcttatgaaaagcttaaagagataatagaggagcagggtggggac
cctaatataaagccagaagatattcctataggagataaaacctacacatttgtggcccaa
acttcaggatatataactagaattgacaataaggctataacggcaatagctagagccgcc
ggggcccctgaggataagggggcaggaataatgttacatgtaaaggtaggagaaaaagta
aaagagagagatccactgttcacggtacatgcagaaagtggaacccgactggatcaagct
ataatacaagcaagaaggatggaaccgataagaatagaaggaatggtattacagagaatt
ggaaacatctaa

DBGET integrated database retrieval system