KEGG   Thermococcus sibiricus: TSIB_0768Help
Entry
TSIB_0768         CDS       T00928                                 

Definition
Glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
tsi  Thermococcus sibiricus
Pathway
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(700552..702057)
Genome map
AA seq 501 aa AA seqDB search
MDYFLVLDVGTTNIKALAFSQGELVASFEERPKPYYPHPGWVEEDPKEVIEIVYKLLDKA
EEELGKPLGVALTNQRSSTVLWDKETGEPLYNMITWQDTRTEDIIEKFSSKFMVRFGNTL
GKVLNILSKGLPFIRDTRKGAYIITLAYVQFGTTHSSMHLRWLMENVPEAKKAMEKDSAI
FGTVDSWISWNLTGKHVTDYTNASATGLFDPFYLKWSDNITKIVEIPKKILPQVVPNDTP
IGEIKDYNVPLLTVIADQQASIYAAGVSKGTTKMTNGTGTFIDINVGEKPLPGALGLYPM
VALGTKEHTLYLLEGSVITSGSAVEWLVDVGLIKDYSEISTAFAESENEVIFIPALSGLG
TPHIRPNVKGTLFDITRGTKRTDLVKGMIEGIAMRCAEIIDHMESNSRIKIERIIADGGL
SKSDEFLQSVADLSSKDIMRPKYLNASAYGAYLLSEAVYSQRDVIASWKPPKIEKIFRPM
NKRSEFKKKWKKRLKTVIEAY
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggattatttcctcgttttggatgtgggaacaaccaatataaaggcgttagcattttcc
caaggagagctggtagcaagttttgaagaacgccctaaaccctactacccccaccccgga
tgggtggaagaagaccccaaggaggtcattgagattgtttacaaacttctggataaggcc
gaagaagagcttggcaaacccctaggcgttgcactcacaaaccaacgaagcagtactgtt
ttatgggataaagagaccggagaaccattatataatatgattacatggcaggatactagg
acagaagatattattgagaagttctcctcaaaattcatggttagatttgggaatacgctt
ggaaaagtacttaatattctctccaaaggtcttccgttcatccgagatacacgaaagggt
gcatatataattaccctagcctatgtccaatttggaacaacgcattcatcaatgcacctt
cggtggcttatggaaaatgttccagaagctaaaaaggccatggagaaagattctgcaatt
tttgggacagttgactcatggatttcatggaatctaactggaaaacatgttacagattac
accaacgcaagtgctaccggactctttgaccccttctatttaaagtggagtgataatatt
actaaaatagtcgaaataccaaagaaaattcttccccaagtagtgccaaatgatactcca
attggagagatcaaagactacaatgttcccctactaactgtaatagcagaccaacaagcc
tctatttacgcagctggagtttcaaaagggacaacaaaaatgacaaatggaactggaacc
ttcatcgacatcaatgttggtgaaaagcctctcccaggagctcttggcctctatccaatg
gttgctttgggcacaaaagaacacactttatatcttcttgaaggatctgtaataacttcc
ggctctgcagtggagtggcttgtagatgtgggccttataaaagactattctgagatatca
actgcctttgcagagagtgaaaatgaagtgatattcatacctgcactttctggtcttggc
accccccatatcaggccaaatgttaagggaacactctttgatattacaagagggacaaaa
agaactgacttagtcaaagggatgatagagggaatagccatgaggtgtgcagaaataatt
gaccacatggaatcaaactccaggataaagattgaaaggataatagccgatggaggcctt
tcgaaaagcgatgagttcctccaaagtgtggctgacttatcatccaaggatataatgagg
ccaaagtatttaaatgcctcagcttacggtgcttatttgctttcggaagctgtttattcc
caaagagacgtcatagcctcgtggaaacctcccaaaattgagaaaattttccgacccatg
aataaaagaagcgaattcaagaaaaagtggaaaaagagattaaaaactgtgatcgaagct
tattga

DBGET integrated database retrieval system