KEGG   Thermococcus sibiricus: TSIB_0898Help
Entry
TSIB_0898         CDS       T00928                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tsi  Thermococcus sibiricus
Pathway
Glycine, serine and threonine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:tsi01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:tsi00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
813338..814669
Genome map
AA seq 443 aa AA seqDB search
MIKCVKCGREYDHFFPPRCICGALLEIGYDYSSVDITKWKTRERGVWKYKELLPPVKKVI
SLKEGGTPLVRAKIGEKLGFAVFIKDETRNPTGSFRDRLATVGVSYGLSHANNGFIVASD
GNAAASLAAYAARANKEAFVVVPKKVDRGKLIQMIAFGAKIIKYGDSVDECIEYASELSR
LNGLYDITPENNIIGLEGQKTLAFELWEDINPTHVIIPTGSGSNLYSIYKGFKELLEVGA
IEELPKLVAVQTENCSPIASEILGLTSKKDFTKALGLYVKDPVNKELATNAVKESGGTAV
LVREEELDLGEKELAKEGVFAEYSSAVVIPALLKLHEEGYFEKDDKVALVVTGSGLKSYY
AEEKERFSIGGTKLSILRLLRGRSMYGYELWENLEKPMKYQAVYQHIRELESLELIEEAY
KRGRRTYYKLTEKGQRLLENFEG
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgataaaatgtgttaagtgtggaagagaatatgaccacttttttcctcctaggtgcata
tgtggtgcacttcttgagatcggatatgattattcatctgtagatattactaaatggaaa
actcgagaaaggggggtatggaaatacaaggaacttttgcctccagtcaaaaaagtaatc
tccctcaaggaaggagggacgccattagtcagagcaaaaattggtgaaaagctcggtttt
gcagtttttattaaggatgaaactcgaaaccctactggttcatttagagatagattggca
actgtaggggtttcttatggtctatctcatgctaacaatggttttattgttgcgagtgac
gggaacgcagcggcttctctagctgcttatgcagcaagggcaaacaaagaggcctttgtt
gtggtccctaaaaaagtggatcggggaaaacttattcagatgattgcatttggcgcaaag
atcataaaatatggagatagtgtggatgagtgtattgaatatgcatcagaactctcccgg
ctaaatggtctatatgatataactccggaaaacaatataattggacttgaagggcaaaaa
actcttgccttcgaattgtgggaggacatcaatccaactcacgtcattattcctactggg
agtgggagcaatttatacagtatatacaaaggctttaaagaacttttagaggtaggggcc
atagaagagcttccaaaattggtagcagtacaaactgaaaattgttctccgattgcatca
gagatattgggtttaacatcaaaaaaagacttcacaaaggccttaggcctttatgtcaaa
gatcctgttaataaggaacttgcaacaaatgctgtgaaagaaagtggagggactgcagta
cttgtcagggaagaggagcttgatcttggagaaaaggagcttgcaaaggagggagtcttt
gctgaatattcatcagcagttgttattccagctttgttgaagttgcatgaggagggatat
ttcgagaaagatgataaagttgcattggttgtaacaggatcaggtctcaaaagctattat
gcggaagaaaaagaacgtttttcaataggtggaacaaaattaagtatcctccgcttattg
agaggaaggtccatgtacggttatgaactttgggaaaatctagaaaagcccatgaaatac
caagcagtttatcagcatataagagagcttgaaagtctcgagttgatagaagaagcttat
aaacgtggtagaagaacatactacaaactcactgaaaagggacaaagattacttgaaaac
tttgagggataa

DBGET integrated database retrieval system