KEGG   Thermococcus sibiricus: TSIB_0949Help
Entry
TSIB_0949         CDS       T00928                                 

Definition
glyceraldehyde-3-phosphate dehydrogenase (EC:1.2.1.59)
Orthology
K00150  
glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
tsi  Thermococcus sibiricus
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:tsi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TSIB_0949
   01230 Biosynthesis of amino acids
    TSIB_0949
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TSIB_0949
Enzymes [BR:tsi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     TSIB_0949
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
862089..863093
Genome map
AA seq 334 aa AA seqDB search
MKVKVGINGYGTIGKRVGYAVSKQADMELVGVAKTKPDFEAYRAKELGIPVYAASPDFVP
RFEKVGFEIVGTLEDLLEKVDVIVDATPGGMGEKNKALYEKAGVKAIFQGGEKASVAEVS
FVAQANYEKALGKDYVRVVSCNTTGLTRTLNAIKDYIDYVYAVMIRRAADPNDIKRGPVN
AIKPSVEVPSHHGPDVQTVIPINIETMAFIVPTTLMHVHSVMVELKKPLTREDVIKIFEN
TTRVLLFEKERGFDSTAQLIEFARDLHREWNNLYEIGVWKESISVKGNRLFYIQAVHQES
DVVPENIDAIRAMFELADKWESIKKTNKSLGILK
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttaaggtgggaattaacggttacggtactataggaaaaagagtgggttatgca
gtatcaaaacaggctgatatggaattagtgggtgttgcaaaaacaaaaccagattttgag
gcttaccgagctaaagagcttgggatacccgtttatgccgcatcgcctgattttgttcca
agatttgagaaagttgggttcgagattgttggaacccttgaagatctcctcgagaaagtg
gatgtaattgtggatgctactcccggagggatgggcgagaaaaacaaggccctctacgag
aaagcaggagttaaggcaatattccaaggcggagaaaaggcaagtgttgctgaggtttca
tttgttgctcaggcaaactatgagaaagctttgggcaaagactatgttagagtagtttct
tgcaacactacaggtttaacaagaactttgaatgcaataaaggactacattgactacgta
tatgctgtgatgattagaagggccgcagatcccaacgacatcaaaagaggtcccgttaat
gccataaaacccagtgttgaagttccttcccatcatggaccagatgtacagaccgtaatt
ccaataaacattgaaacaatggcctttatcgtaccaacaaccctcatgcacgtccacagt
gtaatggtggagctcaaaaagccccttacaagggaagatgttattaagatttttgaaaac
actacaagagttctgctatttgagaaggaaaggggctttgacagtacagcccagttgata
gaattcgcccgtgatttgcacagggagtggaacaacctctatgagataggagtgtggaag
gaaagcattagcgtaaagggtaacaggctattctacatccaagcggttcatcaggagagt
gatgtggttccagaaaatattgatgcaataagagctatgtttgaattagcggacaagtgg
gagagtatcaagaagactaacaaaagtctcggtattttgaagtag

DBGET integrated database retrieval system