KEGG   Thermococcus sibiricus: TSIB_1067Help
Entry
TSIB_1067         CDS       T00928                                 

Definition
arginase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
tsi  Thermococcus sibiricus
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:tsi00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(969599..970456)
Genome map
AA seq 285 aa AA seqDB search
MLFGIPPSEKPNLYILGIPWDNSSSYRRGCDKGPEAIREATSEELYNSFNESLVNLAEHW
RYKDLGDVKVENFEELVERVDDLVKRHYTGELFLFLGGDHSITYATFRALKKVSQEEFGL
IYFDAHPDLYPEYEGDKYSHACTVRRLVEEDLVKGKDVVQIGVRAPTKQQIEFAEEHGIK
IISASEIYRCQKVDVPFKKAYLSFDMDVLDPAFAPGVGNPESGGLTTRELVEVIKSIKTE
VVAFDVVELNPSYDYKGITAFAAAKIVREILGKTAKNELTLHAGG
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgctttttggaattcctccctctgaaaagccgaacctttacatcctcggaattccttgg
gacaactcatcttcttataggcgaggctgtgataagggcccggaagctataagagaagca
acatctgaggaactttacaacagcttcaacgagagtcttgtgaaccttgctgaacactgg
cgctacaaggatctaggggatgtaaaagtagaaaactttgaagagcttgttgaaagggtt
gatgacctcgttaaaaggcattacaccggagaactcttcctcttccttggaggcgatcat
tcaataacctatgcaacgttccgggcgttgaaaaaagtgtctcaggaggaatttggtctc
atatacttcgatgcgcatccagatctttatcctgagtacgagggggataaatattcccat
gcatgtactgtgagaaggcttgtggaagaggatcttgtgaaaggaaaagacgtagtccaa
ataggggttagagctcccaccaaacagcaaattgaatttgcagaagagcacgggataaaa
ataatttcggcctctgaaatatatcgttgtcaaaaagtagatgtgccttttaagaaagct
tatctttccttcgatatggacgttctcgatccagcttttgctcccggagttggtaacccc
gaatctgggggattaaccacaagagagctcgttgaggttataaagagcataaaaacggaa
gtggttgcctttgatgttgttgaactcaacccaagttatgattacaaaggcataactgct
ttcgctgccgcaaagatagttagagaaattttaggaaaaactgcaaaaaatgagttaact
ttgcatgctgggggttaa

DBGET integrated database retrieval system