KEGG   Thermococcus sibiricus: TSIB_1099Help
Entry
TSIB_1099         CDS       T00928                                 

Definition
Acetyl-CoA synthetase I (ACSI, ADP-forming), subunit beta (EC:6.2.1.13)
Orthology
K01905  
acetyl-CoA synthetase (ADP-forming) [EC:6.2.1.13]
Organism
tsi  Thermococcus sibiricus
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tsi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TSIB_1099
   00620 Pyruvate metabolism
    TSIB_1099
   00640 Propanoate metabolism
    TSIB_1099
Enzymes [BR:tsi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.13  acetate---CoA ligase (ADP-forming)
     TSIB_1099
Lipid biosynthesis proteins [BR:tsi01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   TSIB_1099
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1000182..1000880
Genome map
AA seq 232 aa AA seqDB search
MDRVAKAKEIIEKAKAENRPLVEPEAKEILQLYGVPVPEFKVATNEEEAVQFAREIGYPV
VMKIVSPQIIHKSDAGGVKVNIKSDEEAKEAFNTIMKNAKNYKPDADLWGVIIYKMLPLG
KEVIVGMIRDPQFGPAIMFGLGGIFVEILKDVSFRVAPISKEEALEMIKEIKAYPILAGA
RGEKPVNIEALAEIIMKVGELALELPEVKELDINPVFAYEDTSVAVDARILL
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atggatagagttgcaaaagctaaggaaataatcgaaaaagcaaaagctgagaatagacca
cttgtagagcccgaagcaaaggaaattcttcagctatacggagttcctgttcccgagttc
aaggttgctacaaatgaggaagaggccgtccaatttgcaagggaaataggatatcccgta
gttatgaagattgtctctccacaaattatccacaagagcgatgcgggtggtgttaaggtc
aacataaaaagcgatgaggaggctaaagaagcctttaataccattatgaagaacgccaag
aactataaacctgatgctgacctttggggggttattatctacaagatgcttccacttgga
aaggaagtcatcgtgggtatgataagagacccacaattcggaccggccatcatgtttggt
cttggtggaatttttgtcgaaatcttaaaagatgttagctttagagttgctccaataagc
aaagaggaagcacttgaaatgataaaagagatcaaggcctatccaatccttgctggggca
aggggagaaaaaccagtaaacattgaagctctagctgagatcatcatgaaagttggagag
cttgctctagagctcccagaagtaaaagaattagatatcaatccagtatttgcctacgaa
gacacctctgttgctgtcgatgcaagaatacttctttaa

DBGET integrated database retrieval system