KEGG   Thermococcus sibiricus: TSIB_1117Help
Entry
TSIB_1117         CDS       T00928                                 

Definition
(GenBank) Threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
tsi  Thermococcus sibiricus
Pathway
tsi00260  Glycine, serine and threonine metabolism
tsi01100  Metabolic pathways
tsi01110  Biosynthesis of secondary metabolites
tsi01120  Microbial metabolism in diverse environments
tsi01230  Biosynthesis of amino acids
Module
tsi_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:tsi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TSIB_1117
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    TSIB_1117
Enzymes [BR:tsi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     TSIB_1117
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACS90171
UniProt: C6A3H6
Position
complement(1018340..1019518)
Genome map
AA seq 392 aa AA seqDB search
MVLKCIECGRKYDENDLRYRCECGGLLEVVTDLDRAEDVFDGKNVTLWKYKSWLPVKSRV
SLNEGGTPLYKLKNLEKGFGVEIYAKNEGANPTGSFKDRGMTVGVSKALELGMDKVICAS
TGNTSASLAAYAARAGIKAYVLVPSGKIALGKLAQAIIYGARVVPVRGNFDDALRVVVEA
SAKLGVYMLNSINPFRLEGQKTIALEIYDQLGFVPDNIVLPVGNAGNISAIWKGFKELYE
KGITEKLPRMMGIQAEGASPLVRAWKTGEKFKPIEKPETVATAIRIGNPANWPKAWRAVK
ESGGLFESVSDEEILQAQQLLASKEGLFVEPASAASLAGLIKLLEIGEVDRSESYVLITT
GHGLKDPNVVLNRFTLPEPIEPTLDAFKEVIR
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggttttgaagtgtattgagtgtggaagaaaatatgacgaaaatgacctccgctaccgc
tgtgagtgtggtgggctacttgaggtcgtcacggacctcgatagagcagaggacgtcttc
gacggcaagaatgtaacgctgtggaaatacaagagttggctaccagttaagagcagggtt
tcgctgaatgaaggtggaacaccactctacaagctcaagaaccttgaaaagggctttggt
gtcgaaatatatgccaaaaacgaaggagcaaaccctacgggttcttttaaggatagaggg
atgacagttggcgtctccaaagccctagaactcggtatggacaaggtgatatgtgcatcc
actggcaatacatcagcgtctttggcagcttacgcagcgagggcggggattaaagcttat
gtcctagtgcctagcggaaagatagctcttggaaagcttgcacaggctataatttacgga
gccagggttgtacctgtaagaggcaactttgacgatgcactcagagttgtagtggaagcg
agcgcaaagcttggtgtttacatgctcaattccataaacccctttaggctggaaggtcag
aagacaatagcactagagatttatgaccaactcggtttcgtacccgacaacatcgtccta
cccgttggaaatgcaggtaacatctcggcaatttggaaggggttcaaggagctttacgag
aaaggaataacggagaaactcccgagaatgatggggatacaggcagaaggcgcatcccct
ctcgtgagggcttggaaaacaggggagaagtttaaacctatcgaaaagccggagaccgtt
gcaaccgccataagaataggcaaccctgccaactggcccaaggcatggcgtgccgtcaaa
gaatcaggggggctatttgaaagcgtaagcgacgaggaaatactccaggctcaacaacta
ctggcgagtaaagaaggcctgtttgttgaacccgcatccgctgcatcactggcaggactt
ataaagcttcttgagataggtgaggttgatagaagtgaaagctatgttctcataacgaca
ggtcacgggttgaaggatccaaatgttgttctcaacaggttcacacttcctgagccaata
gaaccaacacttgatgcgtttaaagaggtgatacgatga

DBGET integrated database retrieval system