KEGG   Thermococcus sibiricus: TSIB_1368Help
Entry
TSIB_1368         CDS       T00928                                 

Definition
Carbohydrate/pyrimidine kinase, PfkB family (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
tsi  Thermococcus sibiricus
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:tsi00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    TSIB_1368
Enzymes [BR:tsi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     TSIB_1368
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1226634..1227581
Genome map
AA seq 315 aa AA seqDB search
MEKVSPPEKNKSIDLQKKSEVGKVFDIVAIGNLNYDVTLLVERFPEFHEKVIAKKAHFGL
GGAAGNTASWLSQMGLKVGFIGAVGNDEIGEAHISYFKKIGVDVEGIKVVNEPSGIAISM
IKNEDKRIVKHLGANAHREIDLEYLSRARYIHMSSNPKEIIEKTAKFAHKRDIPVFLDIG
EAELPKSVEDKITYLLMNEDEFKRKYGSLENLQAVKSKNLIITLNGGGALLRNERGEIFK
VKGLSAKVIDSTGAGDAFDAGFIYGIIKGWRLKEAATLGTFLAYLSVQKVGARTAIIGIE
EIKKKAKELNIELPF
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaagtctccccacccgaaaaaaataaatctattgacctacaaaaaaagagcgag
gtggggaaggtgtttgatatagttgcaattggtaaccttaactatgatgtcactctttta
gtagagagatttcctgaatttcatgaaaaggtaatcgccaagaaagcccattttggatta
ggtggagctgcaggcaatactgcctcctggctctctcaaatgggccttaaagttggattt
atcggtgctgtgggcaatgacgagattggagaggcccatataagttacttcaaaaaaata
ggagttgatgtagaaggaattaaagtggtgaacgagccctctggcatagcaatatccatg
ataaagaacgaagataagagaatcgtcaagcatctgggagcaaacgcccacagagaaatt
gatctggaatacttatcgagagcgagatacattcacatgtcttcaaatccaaaggagatt
atagaaaagacagcgaaattcgcccataagagggatatacctgtttttcttgatataggg
gaggcagagcttcccaaatcagttgaagataagatcacctaccttctgatgaatgaagat
gagttcaaacgaaagtatggaagtttagagaatctccaagctgtaaaaagcaaaaattta
ataataaccctgaatggtggtggtgccttgctccgaaatgaaagaggagaaatcttcaaa
gttaaaggattaagcgctaaagtcatcgactccacgggggccggagatgccttcgatgcc
ggatttatttacggtataataaagggatggagattgaaagaagccgcaactttaggaact
tttctagcatatttaagtgtccagaaagtaggggccagaaccgcaataataggcattgaa
gaaattaaaaagaaagccaaggaacttaatatagaactcccattttaa

DBGET integrated database retrieval system