KEGG   Thermococcus sibiricus: TSIB_1378Help
Entry
TSIB_1378         CDS       T00928                                 

Definition
(GenBank) Pyruvate:ferredoxin oxidoreductase (POR), subunit beta
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
tsi  Thermococcus sibiricus
Pathway
tsi00010  Glycolysis / Gluconeogenesis
tsi00020  Citrate cycle (TCA cycle)
tsi00620  Pyruvate metabolism
tsi00640  Propanoate metabolism
tsi00650  Butanoate metabolism
tsi00680  Methane metabolism
tsi00720  Carbon fixation pathways in prokaryotes
tsi01100  Metabolic pathways
tsi01120  Microbial metabolism in diverse environments
tsi01130  Biosynthesis of antibiotics
tsi01200  Carbon metabolism
Module
tsi_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tsi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TSIB_1378
   00020 Citrate cycle (TCA cycle)
    TSIB_1378
   00620 Pyruvate metabolism
    TSIB_1378
   00640 Propanoate metabolism
    TSIB_1378
   00650 Butanoate metabolism
    TSIB_1378
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    TSIB_1378
   00680 Methane metabolism
    TSIB_1378
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    TSIB_1378
Enzymes [BR:tsi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     TSIB_1378
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C DXP_synthase_N
Motif
Other DBs
NCBI-ProteinID: ACS90429
UniProt: C6A484
Position
complement(1234752..1235699)
Genome map
AA seq 315 aa AA seqDB search
MAVRKPPITTREYWAPGHAACAGCGPAIVMKLATKAFSEAMEEKYGDPNAFAIAQATGCM
EVVSAVFPYTAWKAPWIHVAFENAAAAASGVEAAWKKLGRKGKILAIGGDGGTADIGLQA
LSGMLERRHNVVYLMYDNEAYMNTGIQRSSSTPYGAWTTTSPPGKYSIGEDKPKKWVALI
AAAHQVPYVATASIGDPYDFYRKMKKAASVDGPAFVQVLAPCVPGWRTPPEKTVEIAKLA
IESGLWPLFEIENGDFYNIKFQRFPKDGKFKKPIEDYLKIQGRFKHLFKRPEAIQELKNQ
IKEVWRILGKEVELL
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atggcagttagaaagccccctatcacaactcgcgaatactgggcaccgggtcatgccgca
tgcgctggatgtggccctgctatagtgatgaagcttgccacaaaggcatttagtgaggct
atggaagaaaaatatggtgatccaaacgcatttgctattgcccaagccacaggatgtatg
gaagttgtttctgctgtattcccatatacagcttggaaagccccatggattcacgtggca
tttgaaaacgctgcagctgcggcaagtggtgttgaagccgcatggaagaaacttggtaga
aaaggaaagattcttgcaattggtggagatggtggtacagcagacataggtctccaagcc
ctttcaggaatgcttgagaggagacacaatgtagtttatcttatgtatgataatgaggct
tacatgaatactggcattcagaggtcttcatcaacaccatacggagcatggacaaccacg
tcacctccaggaaagtactcaattggcgaagacaagccaaagaagtgggttgctcttata
gctgcggctcatcaagtcccatatgtggccactgcaagcattggagacccatatgatttc
tacaggaagatgaagaaagctgcaagtgttgatggcccggcatttgttcaagtattagct
ccatgtgttccaggatggaggactccgccagagaaaactgtcgaaattgcaaaactagca
attgaaagtggtttgtggccattatttgagattgaaaatggtgatttctacaacataaag
ttccagagattcccgaaagatggaaagttcaagaaaccaattgaggattacctcaaaatc
caaggcagatttaagcaccttttcaagaggccagaagccatccaagagctcaagaaccag
attaaagaggtatggagaatacttggcaaagaagttgaacttctttga

DBGET integrated database retrieval system