KEGG   Thermococcus sibiricus: TSIB_1379Help
Entry
TSIB_1379         CDS       T00928                                 

Gene name
porA
Definition
pyruvate ferredoxin oxidoreductase subunit alpha (EC:1.2.7.1)
Orthology
K00169  
pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1]
Organism
tsi  Thermococcus sibiricus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tsi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TSIB_1379 (porA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TSIB_1379 (porA)
   00020 Citrate cycle (TCA cycle)
    TSIB_1379 (porA)
   00620 Pyruvate metabolism
    TSIB_1379 (porA)
   00640 Propanoate metabolism
    TSIB_1379 (porA)
   00650 Butanoate metabolism
    TSIB_1379 (porA)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    TSIB_1379 (porA)
   00680 Methane metabolism
    TSIB_1379 (porA)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    TSIB_1379 (porA)
Enzymes [BR:tsi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     TSIB_1379 (porA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1235710..1236894)
Genome map
AA seq 394 aa AA seqDB search
MPMRKVMKGNEAAAWAAKLAKPKVVAAFPITPSTLVPEKISEFVADGEMDAEFIKVESEH
SAISACVGASAAGVRAFTATASQGLALMHEVLFIAAGMRLPIVMAIGNRSLSAPINIWND
WQDTISERDTGWMQFYAENNQEALDLILIAFKVAEDERVLLPAMVGFDAFILTHTVEPVE
IPDQEVVDEFLGEYVPKHAYFDPAKPITQGALGFPAHYMEARFTVWEAMENARQVIAEAF
DEFEKKFGRRYHMIEEYKTDDAEIILLTMGSLAGTLKEFIDKKREEGLKIGAAKMTVYRP
FPIEEFRALAKKAKVLAILEKDISFGIGGAVFADAGRALVNEKEKPILLDFIIGLGGRDV
TFENLEDVVEISKKALDGEKVEEVNWIGLRKEIL
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgccaatgagaaaggttatgaaaggtaatgaagccgctgcatgggcagcaaaacttgca
aagcctaaggtcgtagctgcattccctattacgccatcaactctcgttcctgagaagatt
agtgaatttgttgctgatggagaaatggatgctgagtttataaaagttgaaagtgagcat
tcagcaatttctgcatgtgttggtgcaagtgctgctggagtgagagcttttacagcaaca
gcttcccaaggtttggccttaatgcatgaggtccttttcattgcagctggaatgaggctt
ccaattgttatggcgattggtaacagatcgttgagtgccccaattaatatttggaatgac
tggcaagacacaataagtgagagagacaccggatggatgcagttctatgctgaaaataac
caagaagcactagatttgatattgatagccttcaaagttgcagaagatgaacgcgttttg
cttccagctatggttggatttgacgcattcatattgacccacacagttgagccagttgaa
ataccggatcaagaggtagttgatgagttccttggggaatatgtaccaaaacatgcttac
ttcgatccagctaagccaattactcaaggtgctcttgggttcccagctcactatatggaa
gcaaggttcaccgtttgggaagctatggagaacgcgagacaagtaattgcagaggcattt
gacgagtttgagaagaagttcggaagaagataccacatgattgaggagtacaagactgat
gatgctgagataattcttctcacaatgggttcactcgctggaacactcaaggagttcatt
gataagaagagagaagagggattaaagatcggtgcagcgaagatgaccgtttacaggcca
ttcccaattgaggagttcagggcattagcaaagaaagcaaaggtcttggcaattcttgag
aaggatataagctttggaattggtggagcagtatttgcagatgcaggtagagctcttgta
aatgagaaagagaaaccaatattgcttgactttatcattggccttggaggaagagatgtc
acctttgaaaaccttgaagatgttgtcgagatttcaaagaaggcacttgatggagagaaa
gttgaagaagtcaactggataggattgaggaaggagattttgtga

DBGET integrated database retrieval system