KEGG   Thermococcus sibiricus: TSIB_1380Help
Entry
TSIB_1380         CDS       T00928                                 

Definition
(GenBank) Pyruvate:ferredoxin oxidoreductase (POR), subunit delta
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
tsi  Thermococcus sibiricus
Pathway
tsi00010  Glycolysis / Gluconeogenesis
tsi00020  Citrate cycle (TCA cycle)
tsi00620  Pyruvate metabolism
tsi00640  Propanoate metabolism
tsi00650  Butanoate metabolism
tsi00680  Methane metabolism
tsi00720  Carbon fixation pathways in prokaryotes
tsi01100  Metabolic pathways
tsi01120  Microbial metabolism in diverse environments
tsi01130  Biosynthesis of antibiotics
tsi01200  Carbon metabolism
Module
tsi_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tsi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TSIB_1380
   00020 Citrate cycle (TCA cycle)
    TSIB_1380
   00620 Pyruvate metabolism
    TSIB_1380
   00640 Propanoate metabolism
    TSIB_1380
   00650 Butanoate metabolism
    TSIB_1380
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    TSIB_1380
   00680 Methane metabolism
    TSIB_1380
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    TSIB_1380
Enzymes [BR:tsi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     TSIB_1380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_6 Fer4_21 Fer4_2 Fer4_7 Fer4_9 Fer4_16 Fer4_10 Fer4_15 Fer4_8 Fer4_13 Fer4_17 Fer4_4 Fer4_22
Motif
Other DBs
NCBI-ProteinID: ACS90431
UniProt: C6A486
Position
complement(1236905..1237222)
Genome map
AA seq 105 aa AA seqDB search
MAENPFKADIEKVQKEYSEKMTTGAIVYIPGSSVVNKTGGWRVFMPKFDKDKCIRCFICY
TLCPEPAIYLDEESYPVFDYDYCKGCGICANECPTKAIEMVRETK
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaaatccattcaaagctgatattgagaaagtccaaaaggaatatagtgaaaag
atgacaacaggtgcaatagtttacattcccggaagtagcgttgttaacaagacaggtgga
tggagagttttcatgcccaagtttgacaaagacaagtgtattagatgtttcatatgctat
acactctgtccagaacctgctatatatttggatgaagagagttatccagtttttgattac
gactactgtaagggttgtggaatttgtgcaaatgaatgtccaaccaaggcaattgaaatg
gttagagaaaccaaatga

DBGET integrated database retrieval system