KEGG   Thermococcus sibiricus: TSIB_1382Help
Entry
TSIB_1382         CDS       T00928                                 

Gene name
vorA
Definition
2-ketoisovalerate ferredoxin oxidoreductase subunit alpha (EC:1.2.7.1)
Orthology
K00186  
2-oxoisovalerate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.7]
Organism
tsi  Thermococcus sibiricus
Pathway
Valine, leucine and isoleucine degradation
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:tsi00280]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1238227..1239408)
Genome map
AA seq 393 aa AA seqDB search
MPKKVISGNYAAAYAAKHARVEVVAAYPITPQTSIIEKIAEFIANGEVENLEYVPVESEH
SAMAACIGASAAGARTFTATSAQGLALMHEMLHWAAGARLPVVMVDVNRAMAPPWSVWDD
QTDSLAQRDTGWLQFYAENNQEVYDGVLMAFKIGEHEKVNLPVMVIESAFILSHTYDIVD
MLEQEEVDEFLPPRKPLYSLTDFDNPFSIGALGTPADYYEFRYKIAKAMEEAKKIIKEVG
KEFGEKFGRDYSQMIELYKTEDADIVFMGMGSLMGTVKEAVDIFRSEGYKVGAAKVRWFR
PFPREELYELAKSVEGIAVLDRNFSFGQEGILFNEAKGILYNTDANPIMKNYIVGLGGRD
LTVNDVRKIASNMKKIIEKGELDKEIDWYHLKR
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgcctaagaaagttataagtggtaattatgcggctgcttatgctgccaaacatgcaaga
gttgaggttgtagccgcttatcccattacacctcaaacttcaatcattgagaagatagct
gagtttatagctaatggagaagttgagaatcttgaatatgtgccagttgagagtgaacat
tctgcaatggctgcttgtataggggcatcagctgctggagcaagaactttcacagctaca
tcagcccagggtcttgctttaatgcacgagatgcttcactgggccgctggagcaagactt
ccagtggttatggttgatgttaacagagcaatggcaccaccatggagcgtttgggatgac
cagactgattctctagcccaaagagacaccggatggcttcaattctatgctgaaaataat
caggaagtatatgatggtgttttaatggcattcaaaattggcgaacatgagaaggttaat
cttccagtgatggttattgaaagtgcctttattcttagtcacacttatgatatagttgac
atgctagagcaggaagaggtagatgagttccttccaccaagaaagccactatattcattg
acagactttgataacccattctccattggtgcattagggacgcccgctgactattatgaa
tttaggtataaaattgcaaaagccatggaagaagccaagaaaatcatcaaagaagtgggc
aaagaatttggagagaaatttggaagagattacagtcaaatgatagaactctataagact
gaggacgctgatatagtcttcatgggaatgggttcacttatgggtacagtaaaagaggct
gttgatatctttagaagtgaaggatacaaagttggtgctgcaaaagtaaggtggttcagg
ccattcccaagagaagagctttatgaactagccaagagtgtagaaggaatcgcagtgctt
gataggaacttctcattcggacaggagggaattctcttcaatgaagctaaaggtattctc
tacaacactgacgcaaacccaataatgaagaactacatcgttggtcttgggggaagagac
ttaacagtaaacgatgtgagaaaaattgctagcaacatgaaaaagataattgaaaagggt
gagcttgataaagaaattgactggtaccatttgaagaggtga

DBGET integrated database retrieval system