KEGG   Thermococcus sibiricus: TSIB_1384Help
Entry
TSIB_1384         CDS       T00928                                 

Definition
pyruvate/ketoisovalerate ferredoxin oxidoreductase subunit gamma (EC:1.2.7.1)
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
tsi  Thermococcus sibiricus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Pyruvate:ferredoxin oxidoreductase
Class
Metabolism; Overview; Carbon metabolism [PATH:tsi01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tsi00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:tsi00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:tsi00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:tsi00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:tsi00650]
Metabolism; Energy metabolism; Methane metabolism [PATH:tsi00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1239776..1240336)
Genome map
AA seq 186 aa AA seqDB search
MMIEIRFHGRGGQGAVTAANILAEGAFLEGKYVQAFPFFGVERRGAPVTAFTRIDEKPIR
IKTQIYEPDVVVVLDPSLLDTVDVTAGLKEGGLVIVNTEKTKEEVLEKLKKKPAKLALVD
ATTIALEILGLPITNTSILGAVAKATGIVKIESVEEAIKEAFSGELGEKNAKAAREAFEK
TVVYEL
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgatgatagagattcgttttcacggtaggggtggacaaggtgcagttacagctgcaaac
atcttggcagagggagcattcttagaaggcaaatatgtacaggcatttccattctttggg
gttgaaagaagaggagctccagttacagcatttacaagaatagatgaaaagcctattaga
attaagacccaaatctatgagccagatgtagtggttgttcttgatccttccctcttggac
acagttgatgtaactgctggtcttaaggagggtggactggtaattgtaaacactgaaaag
accaaggaagaggtccttgagaaacttaaaaagaaaccagctaagttggcccttgttgat
gctactacaatagctttagagattctcggattgccaattacaaacacttcaatcctcggt
gcagttgcaaaggccacgggaattgttaagattgaaagtgtagaagaggctatcaaagag
gcattctctggagagcttggagaaaagaacgctaaggctgcaagagaagctttcgaaaag
actgttgtttatgaactttga

DBGET integrated database retrieval system