KEGG   Thermococcus sibiricus: TSIB_1619Help
Entry
TSIB_1619         CDS       T00928                                 

Definition
(GenBank) Aldehyde ferredoxin oxidoreductase (AOR)
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
tsi  Thermococcus sibiricus
Pathway
tsi00030  Pentose phosphate pathway
tsi01100  Metabolic pathways
tsi01120  Microbial metabolism in diverse environments
tsi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tsi00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    TSIB_1619
Enzymes [BR:tsi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     TSIB_1619
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: ACS90670
UniProt: C6A4X5
Position
complement(1462317..1464155)
Genome map
AA seq 612 aa AA seqDB search
MYGYMGKILRIDLTNKKATVEPLKEEVLKKFIGGRGIGAKILWDELKPGICPLSPENKLV
LTVGPLTGTKVQSASRWMAQFKSPLTGTYFRSVGGGFFGAELKFAGYEAIIVEGKAEKPT
YVYINDENVEFRDAERIWGMNTLATREFLKEETDKNAHMVMIGPAGENLVKFSAIVTDGD
FRTAARGGGGAVMGSKNLKAIVVKGSKRPEVYDEKAFDDAFKEQVESYKSNPAFEGFHNL
GTNFAVYPFYTLGHFPTYNFKQKELYGAEIFQPEILSQYVVKHSGCWGCMIRCGKVFKLT
KGPYAGTVWDFPEYETHWSFGGNLGNINVETIVYANMLCDFYGLDTISTGVAIGFAIELY
EKGIIGKSETDGLELRWGDPDIIPELVKRIALRIGIGDLLAEGTRKAAEKIGRGAEKYAI
HVKGLEFPAYDPRSAKAHGLNFATSPIGASHCIGWNKFEIMGIPRKADPFATEGKGEITK
YVQDETAIAETAIFCIFPFNMEMVTIDMYAKMLYAATGIEEFKDPKHLWLAGERIFNLER
AINIREGIDGKYDKMPERIVKEPVLREPSKGQIFEEEILLKDYYKVRGWDENGVPTREKL
RELELDEVAEKL
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atgtatggatatatgggaaaaatattgagaatagatttgacgaacaaaaaagccacggta
gaaccattaaaagaggaagttctcaaaaaatttataggcggaagaggaattggagccaag
attttgtgggatgaactaaagccgggaatttgccctctaagccctgaaaacaaactggtt
ctcactgtaggtccgttaaccggtacaaaagttcaatctgcatcaaggtggatggcccag
tttaaatctccacttacaggaacatactttagaagtgtagggggcggtttctttggtgca
gaacttaagttcgcaggctatgaagcaataatagttgagggaaaggctgagaaacccacc
tatgtttacataaatgatgagaacgtggaatttagagatgcagagagaatatggggaatg
aacactttagccacaagagagtttcttaaggaagagacggacaaaaatgcccacatggtc
atgatagggcctgctggagaaaacctagtaaaattctcagcaattgtgacagatggtgac
tttagaaccgccgctagaggcggtggcggtgctgtaatgggatcaaagaatctcaaggct
atcgtagtaaaaggaagcaaaagaccagaggtttacgacgaaaaagcctttgatgatgct
tttaaggaacaggtggagtcatataagagtaaccctgcgtttgaagggttccacaatctt
ggaacaaactttgctgtatatccattctatacccttggacatttccccacgtataatttc
aagcagaaggagctctatggtgcggaaatattccaaccggaaattctctctcagtacgtg
gtaaagcacagcggttgctggggctgcatgataagatgtggaaaggtgtttaaactcacc
aaagggccctatgcaggaacagtatgggactttccagaatatgagacccactggtcgttt
ggaggaaacctgggcaacataaatgtagagacaatagtctatgccaacatgctttgcgac
ttttatggcctcgacacaatttctacaggtgttgcaataggatttgcaattgaactctac
gaaaagggaattatcggaaagagcgaaactgacggccttgaacttagatggggagatcca
gatattattcctgaactggttaagagaatagccctaagaataggtataggcgatttactt
gcagaaggaacaagaaaggctgctgagaaaattggtagaggcgccgagaagtatgctatc
catgttaaaggccttgaattccctgcatacgatccaaggtctgctaaggcccatggtttg
aactttgccacatccccaataggtgcaagccactgtatcggatggaacaagtttgagata
atggggatcccaagaaaggctgatccatttgccaccgaaggtaagggtgagataacgaag
tacgtccaagatgagacggcgattgcagagactgccatattctgtatattccccttcaac
atggagatggtaaccattgacatgtatgcaaagatgctctatgcagcaacaggtattgaa
gagtttaaggatccgaaacacctctggcttgctggggaaagaatattcaaccttgaaagg
gccatcaatattagggaaggtattgatggtaagtacgacaaaatgccggagaggattgtt
aaagagcctgtattgagggaaccttcaaaaggccagatctttgaggaggagattctcctt
aaggactactacaaagtcaggggctgggatgaaaacggcgttcccacaagggagaagctc
agagagttagaactggatgaagttgcagaaaagctttaa

DBGET integrated database retrieval system