KEGG   Thermococcus sibiricus: TSIB_1641Help
Entry
TSIB_1641         CDS       T00928                                 

Definition
Dihydrolipoyllysine-residue acetyltransferase component of pyruvatedehydrogenase complex (E2)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
tsi  Thermococcus sibiricus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tsi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TSIB_1641
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TSIB_1641
   00020 Citrate cycle (TCA cycle)
    TSIB_1641
   00620 Pyruvate metabolism
    TSIB_1641
Enzymes [BR:tsi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     TSIB_1641
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1485236..1486054
Genome map
AA seq 272 aa AA seqDB search
MVSEEIRMIAEQYDINLSKIKGSGVNGEVTLEDLEKYIREHFFPKVREERKVFGIRKVIA
DRLSKSYREAVHVTLNMETEIDNLIQMRKKLTEKLGEKPSYTVLMLKCIAKAIREFIEIN
ATMEKEKIVIYDNVNINVAVDSPIGLITPVIRNVDKKNLKELLKDYADIVERAKKGSLKE
KDFVGGTFTITNLGMFGVDSFTPIINPPQIAILGLNRITQKPVIKNGETKVASVMVLSLT
FDHRAIDGAPAARFLERVKYYLEHPEKVFEVE
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atggtaagtgaagaaatcagaatgatagccgagcagtatgatattaacctttcaaagata
aaaggctcaggagttaatggggaagttacacttgaagaccttgaaaaatacatacgagag
catttcttcccaaaagtaagagaagagaggaaagtttttggaattagaaaagttatagca
gataggctttcaaagagctacagggaagctgtccatgtaaccctcaatatggaaacagag
attgacaacctcattcaaatgagaaaaaagctcactgaaaaacttggagaaaagccctca
tacacagttctgatgttgaagtgcattgcaaaggctattagagagttcatagagatcaat
gcaacaatggaaaaggaaaagatagtaatctacgataatgtaaatataaacgtggccgta
gacagcccaataggcttgataacccccgtaattaggaatgttgataaaaagaaccttaag
gagcttttaaaagactatgcagatatagttgagagggcaaagaagggttcacttaaagaa
aaggattttgtaggaggcactttcacgattacaaatctcggaatgttcggtgtggattcc
ttcaccccaataataaatcctccccaaatcgcgattttaggtttgaatagaataacacaa
aagccggtcataaagaatggggagacaaaagttgccagtgtaatggtgctctccctaacc
tttgaccacagggcaatagatggggctccggctgcaaggttcttggagagggttaaatac
tacctagaacatccagagaaggtgtttgaagttgagtga

DBGET integrated database retrieval system