KEGG   Thermococcus sibiricus: TSIB_1652Help
Entry
TSIB_1652         CDS       T00928                                 

Definition
(GenBank) Probable threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
tsi  Thermococcus sibiricus
Pathway
tsi00260  Glycine, serine and threonine metabolism
tsi01100  Metabolic pathways
tsi01110  Biosynthesis of secondary metabolites
tsi01120  Microbial metabolism in diverse environments
tsi01230  Biosynthesis of amino acids
Module
tsi_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:tsi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TSIB_1652
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    TSIB_1652
Enzymes [BR:tsi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     TSIB_1652
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP HypA DNA_RNApol_7kD Zn_Tnp_IS1595 zinc_ribbon_2 zf-C2H2_11
Motif
Other DBs
NCBI-ProteinID: ACS90703
UniProt: C6A508
Position
complement(1493591..1494769)
Genome map
AA seq 392 aa AA seqDB search
MVKMFETTLKCTKCGIEYSLASGVYKCRECGAPLDVQYDYEGIRELVEDNDAWFREAPRL
WKYWMFYPISNLRKIVSLNEGGTRLYRMKNLEKKLGFGKLYIKNEGENPTGAFKDRGSSV
EITKALEFHARKVVVASTGNMAASISAYGSKAGLEVTIVVPEGTPIGKLVQAVVYGAKIK
IHGTTYDEALAESERMAKEEDYYLTGNYHYRVEGQKSTGFEIFDQLRFDSPDWIVVPIGA
GTHLRAIWKAAKEFYKVGLIERLPKIAGVQVEGYDAIVKAWKEGMPIKPRKEKKPTVASA
IAVKAPVDGENVLRAIEESKGHLGVVTNEEAMNAGLLLGKEGLFVEPSSSTALALARQMR
EEGIIDKDERIVVIATGHGLKDTKTWESFIKF
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
gtggttaaaatgtttgaaactacgttaaaatgcacaaaatgtggtatagaatattccttg
gcaagcggggtttataaatgtagagaatgtggagctccacttgatgttcaatatgattac
gaaggaataagggagcttgtagaagataacgatgcatggtttagggaggctccgagatta
tggaaatattggatgttttatccaatttcaaatctaagaaagattgtgagcttaaatgaa
gggggtacaaggctttatagaatgaaaaatctggagaaaaaacttggctttgggaagctt
tacatcaaaaatgaaggggagaatccaacgggagcattcaaggataggggctcaagtgtg
gaaataacaaaggctctggaatttcatgcaagaaaagttgtcgtggcttcaactggaaac
atggccgctagtatctccgcttatggttctaaagcaggacttgaagtgacaatagtagtt
ccagaaggaactccaataggtaaactagttcaggctgtggtttatggggcaaagataaag
atccatggaactacctatgatgaggctctggcagagagtgaaaggatggcaaaggaggaa
gattattacttaacgggcaactatcactatagggttgaaggccaaaagagcacaggattt
gagatctttgatcagctccgttttgattcccctgattggattgttgttcctattggggcg
ggaactcatttgagggctatctggaaggctgcaaaggagttctacaaagtgggtcttatt
gaaaggttgccaaagattgcaggagttcaagtagagggttatgatgccatagtaaaggcc
tggaaagaaggaatgcctattaagccaagaaaggaaaagaagcctacagtggcatcagca
atagccgttaaagcacctgtagatggggaaaatgttttaagagctatagaggagagtaaa
ggacacttgggtgttgtaacaaatgaagaagctatgaatgctggtttattgctcggaaag
gaaggtctttttgttgaaccatcatcttcaactgcccttgccttagcaaggcagatgcgg
gaagaaggaataatcgataaagacgaaagaatcgttgtgatagccacgggacatggtctt
aaggatactaaaacatgggagagttttattaaattttaa

DBGET integrated database retrieval system