KEGG   Thermococcus sibiricus: TSIB_1670Help
Entry
TSIB_1670         CDS       T00928                                 

Definition
Pyrazinamidase/nicotinamidase pxnc (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
tsi  Thermococcus sibiricus
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:tsi00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1506465..1507010)
Genome map
AA seq 181 aa AA seqDB search
MEALVIVDMQRDFMPGGALPVPEGDKIIPTIEELIKQFKRKDALIVATRDWHPHNHISFR
ERGGPWPKHCVQNTNGAEIVVKLPDDVIIISKADEPDKEAYSGFEGTNLAEILKEKGVKK
VYICGVATEYCVRATALDALKHDFEVYLVKNAVKGIRPEDEEKVLRELKEKGVEIVSSTE
L
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atggaggctttggtaatagttgatatgcagagagatttcatgccggggggagctcttccg
gtacctgaaggagacaaaataatcccaacgattgaggagctaattaaacagttcaaaaga
aaggatgcattgatagttgctactagggactggcatcctcataaccatataagcttcaga
gaaagaggaggtccatggccaaaacactgtgttcaaaacactaatggagcggaaattgtt
gtaaaactgcctgatgatgtaataataatctcaaaagctgatgaaccagataaggaagca
tactctggatttgaaggaacaaacttagcagagatactaaaagaaaaaggagttaagaaa
gtttatatctgcggggttgcaacagagtactgtgttagggccacagccctagatgccctc
aagcatgattttgaggtttacctcgtcaaaaatgcagttaaaggaataagaccagaagat
gaagaaaaggtcctaagagaactaaaggagaaaggagtagagattgtcagctctactgag
ctttaa

DBGET integrated database retrieval system