KEGG   Thermococcus sibiricus: TSIB_1685Help
Entry
TSIB_1685         CDS       T00928                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tsi  Thermococcus sibiricus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:tsi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TSIB_1685
   01230 Biosynthesis of amino acids
    TSIB_1685
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TSIB_1685
   00051 Fructose and mannose metabolism
    TSIB_1685
   00562 Inositol phosphate metabolism
    TSIB_1685
Enzymes [BR:tsi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     TSIB_1685
Exosome [BR:tsi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   TSIB_1685
  Exosomal proteins of bladder cancer cells
   TSIB_1685
  Exosomal proteins of melanoma cells
   TSIB_1685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1520114..1520788)
Genome map
AA seq 224 aa AA seqDB search
MLEEPVIAINFKTYIEATGKRALKIAKAAEEVYKETGVTIVVAPQLADLYRIAQEVEIPV
FAQHIDPIKPGSHTGHVLPEAVKEAGAVGTLLNHSENRMILADLEAAIRRAEEVGLMTMI
CSNNPKVSAAVAALSPDYVAVEPPELIGTGIPVSKAKPEVITNTVNLVKKINPKVGVLTG
AGISTGEDVKKALELGTVGVLLASGVTKAKDPEKAIRDLVSLII
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgttagaggaaccagttattgccataaattttaaaacttacatagaagcgactggaaaa
agggctttaaagatagctaaagcagcggaagaagtctacaaagagactggtgtgactatt
gtggttgccccccagctggctgacctttataggattgctcaagaggttgagattccggtc
tttgcccagcacattgacccaataaagcccggcagtcatactggacacgtcttgccagaa
gcagttaaagaggctggagctgttggaactctgttaaaccactcagaaaacagaatgatt
ctagctgatttggaggctgcaatcagaagagctgaagaagttggcttaatgacaatgatc
tgttcaaacaatccaaaggtttcagcagctgttgctgcgttaagccctgattatgttgct
gttgaacctccagagcttataggaacgggaattccggttagcaaggcaaagcctgaggtg
attactaatacagtgaatcttgtgaaaaaaatcaacccgaaagtaggggttctaactggg
gcaggaatttcaacaggagaagacgttaaaaaagcattagaacttgggacagttggagtc
ttattggctagtggtgttacaaaggctaaagacccagaaaaagcaataagagatttggtg
tctttgataatttag

DBGET integrated database retrieval system