KEGG   Thermococcus sibiricus: TSIB_1687Help
Entry
TSIB_1687         CDS       T00928                                 

Definition
fructose-1,6-bisphosphatase (FBP)
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
tsi  Thermococcus sibiricus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tsi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TSIB_1687
   01230 Biosynthesis of amino acids
    TSIB_1687
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TSIB_1687
   00030 Pentose phosphate pathway
    TSIB_1687
   00051 Fructose and mannose metabolism
    TSIB_1687
  Energy metabolism
   00680 Methane metabolism
    TSIB_1687
Enzymes [BR:tsi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     TSIB_1687
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     TSIB_1687
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1522920..1524044)
Genome map
AA seq 374 aa AA seqDB search
MAIGEKITISVIKADIGGWPGHCKVHPALIEKANELLNKAKEEGIIIDFHATYCGDDLQL
IMTHKHGVDSEKIHGLAWDIFKEATEIAKELGLYGAGQDLLKDAFSGNIRGMGPGIAEME
ITLRKSEPIVTFHMDKTEPGAFNLPIFRMFGDPFNTAGLVIDPNMHMGFRFEVWDIKEHK
KVILNSPEELYDILALIGAKSRYVIKRVYPKKGHKLPEDEPVAVVSTEKLYEIAGEYVGK
DDPVAIVRAQSGLPALGEVLEPFAFPHIVSGWMRGSHNGPIMPVPLKYATPSRFDGPPRV
VALGWQINKDGKLVGPVDLFEDVAFDEARKKALEIADYMRRHGPFEPHRLPLEDMEYTTL
PSVLKKLEERFEPV
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atggcgattggtgaaaaaataactataagcgtgataaaggcggatattggaggatggccg
ggccactgcaaggttcatccagctttaatagaaaaagctaacgaactcctaaacaaagca
aaagaagagggcataataattgacttccacgcaacctactgtggggacgatcttcagctt
attatgacacacaaacacggcgtcgacagcgagaaaatccacggattggcatgggatata
tttaaagaggctactgagatcgcaaaagaactcggcctttatggagcaggtcaggactta
cttaaggatgcttttagtgggaacatcagaggaatgggtcctggaatagctgaaatggaa
atcactctaagaaagagcgaaccgatagtcacattccatatggacaaaactgaacctggg
gcattcaatttaccaatcttcaggatgtttggagatcctttcaacacagcaggccttgtt
attgatcccaacatgcacatgggctttaggtttgaggtttgggatatcaaagaacataaa
aaagttatactcaattcacccgaggagctgtatgatatcttagcattaattggtgcaaaa
tcaagatatgttataaagcgtgtttatccgaagaagggtcacaaacttccagaagacgag
cctgttgccgttgtaagcactgagaagctttacgaaattgcgggagaatacgtaggaaaa
gatgatccagtggccatagtaagagcccaaagtggacttccagcccttggagaagttctt
gagccattcgcatttccgcatatcgtaagtggttggatgagaggaagtcacaacggccca
ataatgcccgttcccctcaaatatgcaactccttcgagatttgatggacctccgagggta
gtggctctaggatggcagatcaacaaagatggaaagctggtaggacccgttgatctcttt
gaggatgtggcattcgatgaggcaagaaagaaggcactagagattgcagactatatgaga
agacacggtccgtttgaaccacaccgtcttccactggaggatatggagtacactacttta
ccaagtgtattaaagaagcttgaagagagatttgaacccgtttaa

DBGET integrated database retrieval system