KEGG   Thermococcus sibiricus: TSIB_1687Help
Entry
TSIB_1687         CDS       T00928                                 

Definition
fructose-1,6-bisphosphatase (FBP)
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
tsi  Thermococcus sibiricus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:tsi01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:tsi01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tsi00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:tsi00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:tsi00051]
Metabolism; Energy metabolism; Methane metabolism [PATH:tsi00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1522920..1524044)
Genome map
AA seq 374 aa AA seqDB search
MAIGEKITISVIKADIGGWPGHCKVHPALIEKANELLNKAKEEGIIIDFHATYCGDDLQL
IMTHKHGVDSEKIHGLAWDIFKEATEIAKELGLYGAGQDLLKDAFSGNIRGMGPGIAEME
ITLRKSEPIVTFHMDKTEPGAFNLPIFRMFGDPFNTAGLVIDPNMHMGFRFEVWDIKEHK
KVILNSPEELYDILALIGAKSRYVIKRVYPKKGHKLPEDEPVAVVSTEKLYEIAGEYVGK
DDPVAIVRAQSGLPALGEVLEPFAFPHIVSGWMRGSHNGPIMPVPLKYATPSRFDGPPRV
VALGWQINKDGKLVGPVDLFEDVAFDEARKKALEIADYMRRHGPFEPHRLPLEDMEYTTL
PSVLKKLEERFEPV
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atggcgattggtgaaaaaataactataagcgtgataaaggcggatattggaggatggccg
ggccactgcaaggttcatccagctttaatagaaaaagctaacgaactcctaaacaaagca
aaagaagagggcataataattgacttccacgcaacctactgtggggacgatcttcagctt
attatgacacacaaacacggcgtcgacagcgagaaaatccacggattggcatgggatata
tttaaagaggctactgagatcgcaaaagaactcggcctttatggagcaggtcaggactta
cttaaggatgcttttagtgggaacatcagaggaatgggtcctggaatagctgaaatggaa
atcactctaagaaagagcgaaccgatagtcacattccatatggacaaaactgaacctggg
gcattcaatttaccaatcttcaggatgtttggagatcctttcaacacagcaggccttgtt
attgatcccaacatgcacatgggctttaggtttgaggtttgggatatcaaagaacataaa
aaagttatactcaattcacccgaggagctgtatgatatcttagcattaattggtgcaaaa
tcaagatatgttataaagcgtgtttatccgaagaagggtcacaaacttccagaagacgag
cctgttgccgttgtaagcactgagaagctttacgaaattgcgggagaatacgtaggaaaa
gatgatccagtggccatagtaagagcccaaagtggacttccagcccttggagaagttctt
gagccattcgcatttccgcatatcgtaagtggttggatgagaggaagtcacaacggccca
ataatgcccgttcccctcaaatatgcaactccttcgagatttgatggacctccgagggta
gtggctctaggatggcagatcaacaaagatggaaagctggtaggacccgttgatctcttt
gaggatgtggcattcgatgaggcaagaaagaaggcactagagattgcagactatatgaga
agacacggtccgtttgaaccacaccgtcttccactggaggatatggagtacactacttta
ccaagtgtattaaagaagcttgaagagagatttgaacccgtttaa

DBGET integrated database retrieval system