KEGG   Thermococcus sibiricus: TSIB_1807Help
Entry
TSIB_1807         CDS       T00928                                 

Definition
Histone acetyltransferase Elp3 like protein
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
tsi  Thermococcus sibiricus
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1626546..1628327)
Genome map
AA seq 593 aa AA seqDB search
MNVMRMEEKYRKACEEIAKVIISGEIKDKDQLNRFKVKIARKYHLSKLPTNSDILRVMRK
DQREKFKEFLKKKPTRTISGVAVVAMMTKPFPCPHGRCIYCPGGPSEGSPQSYTGKEPSA
LRALQNVYHPYLIMMNRLKQLYDIGHDIDKVEVIIQGGTFPAVDLDYQEWFIKEAFKAMN
DFSHFKDIENLEEKIRNAVLFGDIDKDPLFKAAWERTHKKPYYYLEEEQRKNEKAKVRMV
GLTIETRPDWAMEKQIDRMLKLGTTRVELGVQTVFNFIYERVKRGHTVEDTLRATQLLKD
AGLKINYHMMPGLPGSNFERDLKAFQIIFEDERFRPDMLKVYPTLVTKDTILYRWYKEGK
YRPYTTEEAVELLVEVYKMLPKWVRVMRIQRDIPVQLVEAGVKHSNLGQLVFNELVRRGI
RPREIRFREVGHQMQKFGIEPEVEHIKLLREDYEASEGHEIFLSFEDVKNDILIGFIRLR
IPSEKAHRKEINCCPSAIVRELHVYGPLVPIGGKPKYEWQHRGYGRELLAEAERIAFEEF
DRKKMLIISGVGVREYYRKFGYRKDGPYVSKRLDKNGHANFVKSQEFDGHLNT
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtgatgaggatggaagaaaaataccgaaaggcctgcgaggaaattgcaaaggtg
ataatatctggcgagattaaggataaggatcaacttaacaggtttaaggttaaaatagct
aggaaatatcatctaagtaagctccctactaattcagacattctcagggtgatgaggaaa
gaccagagggagaagtttaaggagtttcttaagaagaagccaacaagaactataagtgga
gtggccgttgtggccatgatgacaaaacctttcccatgcccccatggtaggtgtatttat
tgccccggagggccgagtgaaggttctccgcagagttatactggaaaagaaccttcggct
ttgagagctcttcagaatgtttatcatccttaccttataatgatgaaccgcctaaagcag
ctctacgacattggccacgatatagacaaggttgaagttatcatccaaggtggaactttc
ccagctgtggatctagattaccaggaatggttcattaaagaggccttcaaagctatgaat
gacttttcacatttcaaagacattgaaaaccttgaggaaaagataaggaatgcagttctc
tttggagatattgataaagatccactctttaaagcagcctgggaaagaacacacaagaaa
ccttactactatctcgaagaggagcagaggaaaaatgaaaaggcaaaagtcaggatggtg
ggattgacgattgaaacaaggcccgattgggctatggaaaagcaaatagatagaatgctg
aagctcgggacaacgagagtagagcttggcgttcaaacggtgtttaacttcatctacgag
agggttaagagaggacacactgttgaggacactttaagggctacacagctcctcaaagat
gccggtctcaagataaactaccacatgatgccgggcttaccgggaagcaactttgagaga
gacttaaaggcatttcagataatcttcgaggacgaacgcttcaggcctgatatgcttaag
gtttaccccacattggttacgaaggatacgatcctttataggtggtataaagaaggaaaa
tacaggccttatacaaccgaagaggctgttgaactgcttgttgaagtttacaagatgctt
cctaagtgggttagggtcatgagaattcagagagacattccagtgcaactcgttgaagcg
ggtgtaaagcattctaatcttggtcaactggtctttaatgaacttgtgagaaggggaata
agacctagagagattcgttttagagaagttggacaccagatgcagaagtttgggatagag
cccgaagtggaacacatcaaacttttgagagaggattatgaggcgagtgaaggtcacgag
atattcctgagcttcgaggatgtgaagaacgatattctaattggcttcataaggcttaga
attccaagtgaaaaagctcacaggaaagaaataaactgctgtccgtctgctatagttagg
gagctccacgtttacgggccactggtaccaataggtggaaagccgaagtacgagtggcag
caccgcggttacggaagggagctcttagctgaggctgagagaatagcctttgaagaattt
gacagaaagaaaatgcttatcataagtggggttggtgttagggagtactacagaaagttt
ggctatagaaaggatgggccatatgtaagcaagagacttgataaaaatgggcatgccaac
ttcgtgaaaagccaggagtttgatgggcatttgaacacttga

DBGET integrated database retrieval system