KEGG   Thermococcus sibiricus: TSIB_1823Help
Entry
TSIB_1823         CDS       T00928                                 

Definition
Dolichol-phosphate mannosyltransferase, fused to membrane-bound GtrA-like domain (EC:2.4.1.83)
Orthology
K00721  
dolichol-phosphate mannosyltransferase [EC:2.4.1.83]
Organism
tsi  Thermococcus sibiricus
Pathway
Metabolic pathways
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1642604..1643659)
Genome map
AA seq 351 aa AA seqDB search
MISIIIPTYNERENLEELFERISRALEDRDFEIIIVDDDSPDKTWEKAEILGKIYPVRVI
RRTNEKGLSSAVIRGFEEANGDIIVVMDADLQHPPEVIPKLIEAIEHGADISIASRYVKG
GKAENWYWWRKVISKGAIMVGRVALPKIRNIKDPVSGFFAFKREVIENVNLNPVGFKILL
EILIKGKYEKVIEIPFTFGLRKGGESKLSQKQIFNYLKHLYRLMRWEGEIDRLVKFSVVG
LSGVLVNEGTLWGFVEFLGWDKRLAVLPATELSVLNNFVWNDIWTFKDLKRKALYLRLLN
FHFAALTGALVQWAIYLVLLHVGLHYLVANLIGIGFSFIVRFLFNRNITWG
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgatatccataataataccaacgtacaatgaacgtgaaaatttagaggaactttttgaa
cgaatttcaagagcattagaagatagagattttgaaataataatagtggacgatgattcc
cccgataaaacttgggaaaaagcagaaatcctcggaaaaatatatcctgtgagggttata
cgaagaacaaacgaaaaaggcctttcttcagcagttataagagggtttgaagaagctaat
ggagacatcattgtggtaatggatgctgatcttcagcaccctccagaggttatccccaaa
ctaatagaagctattgaacatggagcagatatatcgatagctagcaggtatgttaaggga
ggaaaggctgaaaattggtactggtggaggaaggttatttccaaaggtgctatcatggtt
ggaagggtcgcattacctaaaatacggaatataaaagatccagtaagtggattctttgct
ttcaaacgggaggtcatcgaaaatgtcaatttaaaccctgtgggctttaaaatacttttg
gagatcctcataaaaggaaagtatgaaaaagttattgagattccatttacatttgggtta
agaaagggcggagaaagtaaattgagtcagaaacagatttttaattatttaaagcatctt
taccgcttaatgagatgggaaggagaaatagataggttggtaaagttctctgttgtaggt
ttaagtggggttttggtcaatgaagggacattatggggatttgttgagtttttaggttgg
gacaaaaggttagctgtacttcctgctacagagctttcagtattgaataattttgtatgg
aatgatatttggacatttaaagaccttaaaagaaaagccctttatttacgacttttgaac
ttccactttgcggctcttacgggggcattggttcaatgggccatttacctagttctcctt
catgtgggcctccattatttagttgcgaatttaattggaattggattttcatttatagtg
cgttttctctttaatcgaaatattacatggggatga

DBGET integrated database retrieval system