KEGG   Trichinella spiralis: Tsp_00085Help
Entry
Tsp_00085         CDS       T01609                                 

Definition
dual specificity mitogen-activated protein kinase kinase 4
Orthology
K04430  
mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
tsp  Trichinella spiralis
Pathway
MAPK signaling pathway
ErbB signaling pathway
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:tsp04010]
Environmental Information Processing; Signal transduction; ErbB signaling pathway [PATH:tsp04012]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 366 aa AA seqDB search
MSRRPLLKNLDFSQVSTRKCQQQGSDSTMDLAKSGGYTWPAVNSVPQLDIIRSQSSGILK
ISPEKTFEFTADDLEDLGEIGQGSFGVVYKMRHQISNTVMAVKRMHSTIDDKEQKQLLMD
LDVIMRSDECPYIVQFYGAIFREGDCWICMELMDTSLERFYKMVYENARQRLPEPIIGKI
AVATVKALSYLKDKLHIIHRDVKPSNILLDRSGRIKLCDFGIAGKLVDSIARTRDAGCKP
YMAPERIDPCKSRRGYDVRADVWSLGITLVEIATGQFPYPPWNSVFDQLQQVVDGDPPLL
SPKDYPFFSMDFIYFVNCCLMKDEEQRPKYKQLLETKFITKYEREAVDVGAYVCSVFDSN
ASMSNE
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaggagaccattattgaaaaatttggatttttctcaagttagcactcgaaaatgt
caacaacaaggatccgattctacaatggaccttgccaaatctggtggctacacttggcca
gctgtcaacagtgtgccacaactggatattataagatctcaatcatctggaattttaaaa
atcagccctgaaaaaacttttgaattcactgccgacgatttggaagatcttggagaaatt
ggtcaaggtagttttggtgtcgtttacaaaatgcgtcatcagatatcaaataccgttatg
gcagtaaaacgtatgcattctacgatcgatgataaagaacaaaaacaactgctgatggat
ttagatgtcatcatgcgatcagacgagtgcccttatattgttcagttttatggagctatt
tttagagagggagattgttggatttgcatggagctgatggatacatcattagaacgtttt
tacaagatggtatatgaaaatgcaaggcagaggcttcctgaaccaatcataggaaaaata
gctgttgctactgttaaagcattaagttacttgaaagacaagcttcatataattcatcga
gatgtcaaaccaagcaatattttattggatcgttctggtcgtataaaactttgtgatttt
ggtattgccggtaaacttgtcgattccattgctagaacacgggatgctggttgcaaacct
tacatggcaccggaaaggatcgacccttgcaaaagcagacgtggctacgatgtacgcgct
gatgtttggagtctgggtataactttggttgaaattgccactggccaatttccatatcct
ccttggaattctgtatttgatcaattgcaacaagttgtagatggtgacccgcctttgctt
agtccaaaagattatccatttttcagcatggatttcatttactttgtcaattgctgcctg
atgaaagatgaagaacaacgaccaaaatataagcaacttttggagacgaaatttattaca
aaatatgaacgggaagcagtagatgttggcgcatatgtttgcagtgtgttcgattcaaat
gcgtcaatgtccaatgagtga

DBGET integrated database retrieval system