KEGG   Trichinella spiralis: Tsp_00121Help
Entry
Tsp_00121         CDS       T01609                                 

Definition
glycogen [starch] synthase, liver
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
tsp  Trichinella spiralis
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:tsp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Tsp_00121
Enzymes [BR:tsp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     Tsp_00121
Glycosyltransferases [BR:tsp01003]
 Polysaccharide
  Storage polysaccharide
   Tsp_00121
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 665 aa AA seqDB search
MYFHVVLVVYGTMPENKVSKVLKRLQSMDVNKDFVDDSLDRGETARRESRFVFEIAWEVA
NKVGGIYTVLRTKAAISTEELGDQYCMIGPYNEETVKLEVEVLEPETSHIRGAVESIRSQ
GVKVIFGRWLIDGYPKVILFDITTAAWRLDQWKKELWDSCHIGIPWQDNESNDAVIFGFL
FRDGFDSKPLVIAHFHEWMAGVGLVMARCRKLDLSTIFTTHATLLGRYLCAGNTDFYNNL
DKFDLDREAGNRGIYHRYCMERAAIHAAHVFTTVSEITGIEAQHLLNRKPDVITPNGLNV
VKFAALHEFQNLHAVCKEKISEFVRGHFYGHYNFDLDKTLFFFTAGRYEFSNKGGDLFIE
SLARLNHYLKVGDTSSDVRTKGMTVIAFIIYPANASSFNVESLKGQAVCKQLHDTVTKIN
ANIGRRMFETCLRGNIPSLDELLMPAERVQLKRCILSSKRECLPPICTHNMNDDANDPVL
KHLRRTQLFNKPEDRVKVVFHPEFLSSVSPLIGLDYEEFVRGCHLGIFPSYYEPWGYTPG
EGKFFQSQVRATFPASLSECTVMGIPSVTTNLSGFGCFINEHVADPMSYGVYIVDRRYKN
PEESVLQLSQYYRQARQMALSRTHPERFAELKAEAAKFRYPRPMSEPSTPSHSATGSPYQ
SSEED
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atgtactttcatgttgttcttgttgtttacggtacaatgccagaaaacaaggtatcgaag
gttttgaagagactgcaaagcatggatgtgaacaaagattttgttgacgactctcttgat
cgtggtgaaactgcgcgtcgagagagtcgttttgtttttgaaatagcatgggaagttgct
aataaagttgggggtatttatactgtgttacgtaccaaagcggccattagtactgaagag
cttggtgaccaatattgtatgattgggccttacaacgaagaaactgtgaagttagaagtt
gaagttctcgaaccggagacatctcatattcgtggagctgttgaaagtatacgttctcaa
ggtgtgaaggtaatttttggtcgttggttgatagatggctatccgaaagttattttgttc
gacattactacggcagcatggcgtttagatcagtggaaaaaggaactgtgggattcttgc
cacattggtataccatggcaggacaatgaatcaaatgatgctgtcatttttggatttttg
tttcgtgatggattcgattcgaagccgttggtaattgcccattttcacgaatggatggca
ggtgttggcttggtgatggctagatgtcgtaagttggatttgtcgaccatttttaccacg
cacgccacgttgttgggacgttatttatgcgctggaaataccgacttttataacaatttg
gataaattcgatttggaccgcgaggcgggaaatcgtggcatataccatcgctattgcatg
gaacgagcggccattcatgcggcgcatgtattcacgaccgtttctgaaattactggaatc
gaggcacagcatttgcttaatcgtaagccggatgtgattactccgaacggtttgaatgtt
gtcaagtttgccgcgctacatgaatttcaaaacttgcacgccgtttgcaaagagaagatt
tctgaatttgttcgaggccatttttacggccattacaatttcgatctggacaaaacgttg
tttttcttcaccgctggacgctatgaattttccaacaaagggggtgatttgttcatcgaa
tcgcttgcacgtttgaatcattatttgaaagttggtgatacgagctctgatgtgcgcacg
aaaggtatgacggtaatcgcgtttattatttatccggcaaatgcgagcagcttcaacgtg
gaatcgctgaagggtcaagccgtatgcaaacagcttcacgataccgttacaaaaatcaac
gccaatattggtagacgaatgtttgaaacttgtctcagaggcaatattccatctttggat
gaattactcatgcctgcagaacgagttcaattgaagaggtgcatcttgtcatccaaacga
gagtgtcttcctccgatttgcactcacaacatgaacgatgatgctaacgatccagttttg
aagcatcttcgtcgtacgcagcttttcaacaagcctgaagatcgagtcaaggttgttttt
catccggaatttttgtcttcagtcagtcctttgattggtcttgattacgaagaatttgtg
cgcggttgtcatttgggcatatttccatcttattacgaaccgtggggttatactccaggt
gaggggaaatttttccaatctcaagtgcgagcaacttttccagcttcacttagcgaatgc
acggtcatgggcattccgtcggtaacaacaaacctttctggtttcggatgtttcatcaat
gaacacgtagccgatccgatgagttatggtgtgtacattgtcgatcgtcgttacaaaaat
cccgaagaatctgtacttcagttgagtcagtattatcgtcaagcacgtcaaatggctctt
tcgagaacacatcctgaacgttttgcagaattgaaagctgaggcggcgaaatttcgctat
ccacgaccaatgtcagaaccgtcgacaccttcgcacagtgctactggttcgccttatcaa
agcagtgaagaagattaa

DBGET integrated database retrieval system