KEGG   Trichinella spiralis: Tsp_00300Help
Entry
Tsp_00300         CDS       T01609                                 

Definition
mitogen-activated protein kinase 15
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
tsp  Trichinella spiralis
Brite
Enzymes [BR:tsp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Tsp_00300
Protein kinases [BR:tsp01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [Table]
   Tsp_00300
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 593 aa AA seqDB search
MSEDVDNHVSCRYQIKRRLGKGAYGIVWKAVDKQNGNQIVALKKIFDAFRNQTDSQRTFR
EIMLLLEFRRHPNIIKLLRVIRATGDRDIYLIFEHMDTDLHNVIKKGDILKPVHIQFIMY
QLFCAVLYLHSANVIHRDLKPSNVLLDVNCTVKLADFGLARSLQQINTPSANDLDGSAFP
ELTEYVATRWYRAPEILLSSKYYTKGVDMWSLGCILGEMLNGKPLFPGTSTINQIEKIIE
VILPPSASDIESIGSKYAAAVLKTMVNLPTKTIESTITKAPCFALDLIKRLLVFNPNKRL
SIEESLRHPYVRLFHNPSEEFVMDHKVKLSLNDDVQLSINEYRNKLYELIQRQDFPGDLD
NFSIQPTLNQSDKQFNHIDSNCKPKQSKVIKNRTLKQEKEDSESMHSSNAEENNDNQETV
RPGVAVNGEIGLLPKRSNYFKSFSKGSKLGADRSPGDGHNKSVKNKLNTNESTAAGQFFP
FLQRARSVEVHRKSHQSTTTAKGSADCSTTKRGTLNSTSKGVKSSNGTGHAPSRPIPLSE
TKATLRRSFDSTNFGSFWRRTPSESRAKNPNDWTVITRGQLKAFKELTLGSRS
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaagacgtggacaatcatgtcagttgccggtatcagataaagcgacgcctcggc
aaaggagcctacgggattgtgtggaaagctgtggacaagcaaaatggaaatcaaattgta
gctttgaaaaaaattttcgatgcttttcgcaatcagaccgactctcagcgtacattcaga
gaaattatgctgcttttggaatttcgtcgacatccgaacatcattaaattgttgcgcgtc
atcagggctacaggtgaccgtgatatttatttaatctttgagcacatggacacagacctg
cataacgtgatcaaaaaaggcgacatactcaagccggtccacatccaatttatcatgtat
cagcttttctgtgcggtgctttacctccactcggccaacgtgattcaccgcgatttgaag
ccgtccaacgtcctattggacgtcaattgtacagtcaagttggccgactttggtctagct
cgttcgttgcaacaaatcaacactccctcggctaatgatctcgatggttcagcatttcca
gaactgaccgaatacgtggccacaagatggtaccgggcgccggaaatactcctctcatcc
aagtattacaccaaaggggtcgacatgtggtctcttggttgtatacttggagaaatgttg
aacggcaagccgctgtttccaggcacatcgacaataaatcagatagaaaaaatcatcgaa
gttattcttcctccaagtgcttcggatatagaaagcattggttccaagtatgcagccgcg
gttctgaaaaccatggtcaacttgccgacaaagaccatcgaatccaccataaccaaagcg
ccctgctttgctttggatttgataaaacgtctgctggtattcaacccgaacaaaaggttg
agcattgaagaatccctacgccatccgtacgtgcgcttgtttcacaatcctagtgaagag
ttcgtcatggatcacaaagtgaaactgtccttaaatgacgacgtacagctttcaatcaat
gagtacagaaataaattgtacgaattaatacagcgccaagattttcccggtgatttggat
aatttttcaatacagccaactctcaatcaatcagataaacagtttaatcatattgattcc
aattgtaaaccaaagcagtcaaaagtgatcaaaaatcgaactttgaaacaagaaaaagaa
gattccgaatcgatgcattctagcaatgctgaagagaacaacgataaccaagaaactgta
cgaccgggagttgcggtcaacggggaaattggcttattgccaaaacgaagcaattatttc
aaatcgttttccaagggttccaaattaggcgccgatcgatcgcctggagacggtcataat
aaaagtgtcaagaataagctgaacaccaacgaatcaacggcagccggtcaatttttcccc
tttctccaacgagccagaagcgtcgaagtgcacaggaaaagccaccagtcgacgaccaca
gccaagggttcagcggattgttcgaccacaaagcgtggcacgttgaattcgacgtccaaa
ggggtcaaaagcagcaatggaaccggccacgccccaagcagaccgatccccctgtccgaa
accaaagctacactgaggcgcagcttcgattcgaccaactttggcagtttttggcgccgg
accccgtccgaaagccgtgccaaaaaccccaacgactggaccgtgatcaccagaggtcag
ctcaaggctttcaaagagctcacattaggctcgagatcgtga

DBGET integrated database retrieval system