KEGG   Trichinella spiralis: Tsp_00464Help
Entry
Tsp_00464         CDS       T01609                                 

Definition
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1
Orthology
K00731  
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
tsp  Trichinella spiralis
Pathway
Mucin type O-Glycan biosynthesis
Metabolic pathways
Class
Metabolism; Glycan biosynthesis and metabolism; Mucin type O-glycan biosynthesis [PATH:tsp00512]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 243 aa AA seqDB search
MTTKENHESKAWAVHATWLSRCNGYMFGSSVDDPILHAMNLNVPRGRQYLWRKTRKAFEY
IYANLLNDYDWFLKADDDTYVIVENLRLLLSSYDPDKPHYFGYMLKYNGEPDALYMSGGA
GYVLSRKAVELVVRDVISKRPALDVMFPEDVQMGRCLKQAGRHRFLIIDPVYHLSPEPID
KSFWLSSFTGFPLSKGMTCCSDFAISFHYVQPNMMYVMEYLIYHLRPYGISYRITLWKSE
NVE
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgactaccaaagagaatcatgaaagcaaagcgtgggctgtacacgcgacatggcttagc
cggtgcaacggttatatgttcggttcatcggtcgacgatcccatcttgcatgcgatgaat
ttgaatgtacctcggggacgtcagtatttgtggcgaaaaaccagaaaagcgttcgaatat
atttatgctaatttgttgaacgattatgattggtttttgaaagcagacgacgacacgtat
gttattgtggaaaatttgcgtctgttgttgtcttcctatgatcctgacaagcctcactat
ttcggctacatgttgaagtacaacggtgaaccggatgcgttgtacatgagcggcggtgct
ggttacgtgctgagccgcaaggcggtcgaattggtagttagggatgtgatcagcaaacgg
ccggcgttagacgtaatgtttcctgaagatgtgcagatgggacgttgtttgaaacaggcc
ggtagacatcgatttttgattatcgatcccgtctatcatttatcgcctgaaccaattgac
aaaagtttttggctttcttcgttcactggctttccactttctaagggaatgacgtgctgt
agtgactttgccatatcatttcattatgtccaaccaaatatgatgtatgtaatggaatat
ctgatttatcacctacgtccatatggcatctcatatagaataacattgtggaaatctgaa
aatgtagaataa

DBGET integrated database retrieval system