KEGG   Trichinella spiralis: Tsp_00559Help
Entry
Tsp_00559         CDS       T01609                                 

Definition
putative bromodomain protein
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
tsp  Trichinella spiralis
Pathway
FoxO signaling pathway
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:tsp00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    Tsp_00559
   04330 Notch signaling pathway
    Tsp_00559
   04350 TGF-beta signaling pathway
    Tsp_00559
   04630 Jak-STAT signaling pathway
    Tsp_00559
   04068 FoxO signaling pathway
    Tsp_00559
Enzymes [BR:tsp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Tsp_00559
Transcription factors [BR:tsp03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    Tsp_00559
Mitochondrial biogenesis [BR:tsp03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    Tsp_00559
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 1865 aa AA seqDB search
MADQLALGQPRVKKLKLGSPNLISNNTNNDFNIDWRSLDVELPDELLEPNAAGACHSDVG
GTLQQQGCATATNALNGSVAACNGPTAVVGPPPSTSDSSGDSFNMPSAVTGLSETVTTCS
SSYVSNGLPMSTVSGGGGNSLTVAGNASSLMNAAGVARSPNIRGGAPNNFQEQQAQGAFS
SSGAYMNSSAGAPMPPQYSTLNSQRMPMQAPRPPGSSMLNGHQLNAPGPNAQNGIRMNKN
SGFTNVVQSTPGNPPPMVGNIVPPSHMQQMASPNQMIANQQVNPNPVRMAPGPMGHVPSS
HYQDQHYISSQMIGNVNSARNHTPDYTFPQQQQQQHGVMPPYNAGINYVSQRNQFAGPVP
NSSSPLLASLGDAVTTVAASVQQQQLPMGLNSNAGGIMTSGNIMPTQGNSNGSNTAQDPE
KRKLIQQQLVLLLHAHKCQQRERDPSGQRSQCSLPHCQTMKNVLNHMTGCTEGRACQDGF
PDSPVVRGVVSPSYRYAAPMAASQTSPSFGPSFPPLENASVPKEWHKLVTSDLRQHLVTK
LVKAIFPSPDPAAIHDQRIKDLIQYARKVEKEMFDVAEDREEYYHLLAEKIYKIQKELQE
KKQKRLEMARAQTVASSQPSAPLTPWDSANPPNRVAPVDSLRSVSPSNSSHHFSNATSLG
SNATLSVKNESISVKGEDCTTYDSISVGSVKVEAGPHIKNEPADGQTASVTESVKMENVK
MENVKLEKGNLEIMKSNPEKVFTQDELVRALLPVWERIDRMEEAIPFRVPVDPQLLNIPD
YFDIVKKPMDLLTIKENLLGGEYKKPWDFCDHLSEVFVEEIDPVMRMLGYCCGRKLSFTP
LALVCYGQPMCAIPRDAHYYCYEPKFVVENGIRFVHCTMIRFIPAGLPHCKLSMHVENRV
NKFLRKSNSCAGEVIIRVLASSDKEVEVKPLMKTKFCTIGEIPEKFPYRTKAIFAYEVVD
GVEICFFGLHVQEYGSNCPQPNSRRVYIAYLDSVHFFQPKHIRTAVYHEILLGYLEYVKV
LGYTMAHIWACPPSEGDDYIFHCHPAEQRIPKPKRLQEWYKKMLDKGIVERIVVDYKDIY
KHAQDEHLQSATELPYFEGDYWPNVLEDCIKELDAEEAERRRELEAQAAADAAGDDVEDL
IDEVHIHEKKKSMKIQKKKSQKNKNSQSKKSKKIISGTGNELSDKIYTMMEKHKEVFFVV
RLHSAQAAAVLAPVNDPDALITCELMDGRDSFLSIARERHWEFSSLRRAKFSTMALCYEL
HTQGQDKFVYTCNGCKGTNAMWHCTICDVSFSLMCILLGVGIVEAEVILKFLSQDFDLCQ
ACYEKSNHEHKMEQIKSIISDDNSNSGESGASSANSRNESIQRCMQSLVHACQCRDANCR
RLSCHKMKRVVQHTKVCKKRQVGHCPVCKQLVALCCFHARTCSEPNCSVPFCQNIRQKLN
EQQLQLRKRAQREMQRRMNMMQHQSMPVATTGPPMYHHHHQSAAPSQPSPSVPAVGGQPP
SAPPAAVRAAMEVERIAASQSYARHPNVQMPRQMVAPGANAMATRHVMPASTMGAGSGGC
WGDPGVPPKMVGMRGPPPSQVHRHPATAQQDAAGSFQPGGDGMMNPSMQMAMPPRMPYAD
GRVQMLLQRLKTSNKAEFESLTRELNNDPQLLATVINMRHQQIGSAPQVTPNMVPSPRAQ
WNVSSQVAGNYGVSSPGMPPPSGQGQMQQRPQFYPSTGANSGGGGSAGPQRMPHPSPAQL
GPPSYVSQQQQHDQQRRMGPAPGQYQSGQQAAALGRGYVGSEQQPQAAYGSSQLPRYQIP
VQGEMFFNNINQYAKNAEIEAEILKSHIQIIVHGTTVVNRIGILILTVVWLCFVLCYTIR
LYWIV
NT seq 5598 nt NT seq  +upstreamnt  +downstreamnt
atggccgatcagttggctttgggacagccaagggtgaaaaaactgaaattaggctctcca
aatctcatctctaacaatacgaacaatgatttcaacatcgattggcgatctttggatgtt
gaattaccggatgaattgttggagccgaatgcggccggcgcttgtcactctgacgtcggt
ggcacgcttcagcagcagggttgcgcaacggctacgaatgcattgaacggttcagtagct
gcatgtaatgggccgactgctgttgtcggcccgccgccttccacgtcggattcttccggc
gacagctttaacatgccttctgctgtaaccggattatcggaaacggttacgacttgttct
tcgtcatatgtttccaacgggttgccaatgtcgactgtcagtggaggtggtggtaacagt
cttactgttgctggaaatgctagtagtcttatgaacgctgcaggcgtggccagatcgccg
aatattcgtggtggcgcgccaaataatttccaagaacagcaagctcaaggcgcatttagt
agtagcggtgcatacatgaattcaagcgctggcgctccgatgcccccgcaatattcaaca
ttgaacagtcagcgcatgccaatgcaggctccacgtccaccaggaagttcaatgttaaat
ggtcatcagctgaatgcccctggaccgaatgcacaaaatggtattcgaatgaacaaaaat
agtggatttactaatgtagtccaatcgacacccggcaatccgccacctatggtcggcaac
atagttcctccatcacacatgcaacaaatggctagtccaaatcagatgattgcaaatcag
caggttaatcctaacccagtgagaatggcacctggaccaatgggacatgttcccagtagt
cattatcaagatcagcattacatatcatcacagatgattggaaatgtaaattctgcaaga
aatcatactcccgactacacatttcctcaacaacagcaacagcaacatggtgttatgcct
ccatacaatgcaggcatcaattatgtttcacaaagaaatcagtttgccggccctgtgccc
aatagtagttcgccgctgttggcatcactaggcgatgcagtgacaacggttgcggcgtct
gtacagcagcagcaacttccgatgggattgaattcaaacgctggaggtataatgacaagc
ggcaacattatgcctactcaaggaaattcaaatggaagcaatacggcgcaagatcctgaa
aaacgaaagctaattcaacaacagctggttttgcttttgcatgctcacaagtgtcaacag
cgtgaaagagatccatccgggcaacgttcacagtgtagtttgccccattgccaaacgatg
aaaaacgtattaaatcatatgacgggttgtacggaaggtcgtgcatgtcaagatggcttt
cctgattctccagtcgttagaggagtggttagtccttcgtatcggtacgctgctccaatg
gctgcatcgcaaacatcccctagcttcgggccgagctttccgccacttgaaaatgcatct
gttccgaaagaatggcacaaacttgttacatcagacttgcgtcaacatcttgttacgaaa
ttggtaaaagctatttttccatcaccagatccagctgcaattcacgatcagaggatcaaa
gatttgattcagtatgctagaaaagtggagaaagaaatgtttgatgtggcggaagatagg
gaagaatattatcaccttttagctgagaaaatatataagattcaaaaagaattgcaagaa
aaaaagcagaaacgtttggaaatggctagggcacagacagtagcgtcttcgcagccttct
gctccactgactccttgggattcagcaaatcctccaaatcgagttgctccagtggatagt
ttgcgctcagtttctccatctaactcatctcatcatttctcaaatgctacttctttgggt
tcaaatgcgactttgtcggtaaagaacgagtctatttctgtaaaaggcgaagattgtact
acgtacgattcaatttctgttggttcagtaaaagtggaagcaggacctcatattaaaaac
gaacctgcagatggtcaaactgcttcagtcacagagtcggtgaaaatggagaatgtgaaa
atggaaaacgtcaagctagaaaaaggaaatcttgaaattatgaaatccaatccggaaaaa
gtttttacacaagatgagcttgtcagagcattgttgcctgtttgggagagaattgatcgc
atggaagaagcgattccatttcgtgttccagttgatcctcagctgttaaacattccagat
tactttgacattgtcaaaaagccgatggatttgttgacgataaaagaaaatttgcttgga
ggcgaatacaaaaagccatgggacttttgtgatcatctatcagaagtttttgtggaggaa
attgatcctgttatgcgcatgttgggttactgctgcggtagaaaattatcttttacaccg
ttagcattagtttgttatggccagccgatgtgtgccatacctagggacgctcattattat
tgttatgagccgaaatttgtcgtagaaaatggcatcagatttgtgcattgcaccatgatc
agatttatcccggcgggcttgcctcattgcaaattgtccatgcacgtggaaaaccgggtg
aacaaatttttgcgtaagagcaactcatgcgcaggcgaggttattatacgggttttggct
agctcggataaagaagttgaagtgaagccgttgatgaaaacaaaattttgcacgattggt
gagattccggaaaagttcccttatcgcacgaaagcaattttcgcttatgaagtggtagat
ggagttgaaatttgtttctttggtttgcacgtgcaagaatacggcagcaattgtcctcaa
cccaattctaggagagtttacatcgcatatttggacagtgtgcatttctttcaaccgaag
cacattcgcacggcagtttatcatgaaattctgttgggttacttagaatatgtcaaagtt
cttggttatacaatggcgcacatttgggcatgtcctcctagtgaaggtgatgattacata
tttcattgtcatcctgctgagcagaggataccgaagcctaagagattgcaagaatggtac
aaaaagatgttggataaaggaattgtggaacggattgtcgttgattataaggatatttac
aaacacgcgcaagatgaacatttgcagtcggcgacggaattgccatattttgaaggcgac
tattggccgaatgttttggaagattgcataaaggagttggacgcagaagaggctgagcgt
cggagggaattggaagcacaagcggcagcagatgctgccggagatgatgttgaagatttg
attgacgaagtgcacattcacgagaagaaaaagtcaatgaagatacaaaaaaagaaaagt
cagaaaaataagaactcccagtcgaaaaagagcaaaaaaatcatatctggcactggtaat
gaattgtcggacaaaatttacacgatgatggaaaagcacaaagaggttttctttgttgtc
cgattgcattcagcgcaggcagctgcagtgcttgctccggtgaacgatccagacgcgttg
attacttgcgaattgatggacggtcgtgatagtttcttgtccattgctcgggagcgtcac
tgggaattcagcagtcttcgacgagcgaagttttcaacaatggccctttgctatgaattg
catacacaaggacaagacaaatttgtatacacctgcaacggttgtaaaggaacgaacgct
atgtggcattgtaccatttgtgacgtaagtttttctttgatgtgtatactgctcggtgtt
ggaattgttgaggcagaggttattttaaaatttttatcacaggattttgatttatgccaa
gcctgttatgagaagtcaaatcatgaacacaagatggaacagatcaagtcaattatcagc
gacgataattcaaattctggagagtctggagcgtcgagcgcgaactcaagaaatgaatct
attcagcgctgtatgcaaagcttggtgcatgcttgccaatgccgggatgcgaactgtcga
cggttgagctgtcacaagatgaagcgtgttgttcagcacacgaaagtgtgcaaaaaacgt
caagtcgggcattgtccagtttgtaaacagttggttgcgttgtgttgcttccatgcaaga
acttgttctgagcctaattgttcggtgccgttctgtcagaacatacggcagaagttgaat
gagcagcagttgcagttgcgcaagagagcgcagcgagagatgcaacgccgtatgaacatg
atgcagcatcagtcgatgccagttgcaactactggtccaccgatgtatcatcatcatcat
cagtcagcagcgcctagccagccctctccgtctgtaccggcggttggcggccagccgcct
tcagccccacctgctgctgtgcgggctgcgatggaagtggagcgaattgctgcttcgcaa
agctatgcacgacatccaaatgtacaaatgccacggcagatggttgcacctggtgcgaac
gcaatggcaactagacatgtgatgccggcatcgacgatgggagcaggaagcggaggatgt
tggggcgatcctggtgttccgccgaagatggttggcatgcgtggaccaccaccttctcag
gtacatcgacatcctgcaactgcgcagcaagatgctgctggttcctttcaacccggtggt
gatggaatgatgaatccatcgatgcagatggcaatgccgccacgtatgccttatgcagat
ggtagagttcaaatgttgttgcaacgtctgaaaacatcgaacaaagctgagtttgaatct
ctaacccgtgaattgaataacgatccgcaattgctggctactgtaatcaatatgcgacat
caacagataggaagtgctccgcaggtgactccgaacatggttccaagtcctagagcacag
tggaatgtgagctcacaagtcgctggcaattatggtgtttcttctcctggcatgccacca
ccttctggtcaaggccagatgcaacaaagacctcagttttatcccagcacgggagctaat
agcggtggaggaggatcggctggaccgcaacgaatgccacatccttctccggcgcagttg
ggtccaccatcatatgtcagtcagcagcaacaacacgaccagcagagacgtatgggtcct
gctccagggcaatatcaaagtgggcagcaagctgccgcccttggtagaggttatgttgga
agtgagcagcagcctcaagctgcttatggaagttcgcaacttccgcgttatcagattccg
gttcaaggcgaaatgttttttaataatataaatcaatatgcgaagaatgcggaaattgaa
gctgaaatattgaaaagtcatatacaaattatcgtacatgggacgactgttgtgaacaga
attgggattctgattttgactgtcgtatggttatgttttgttttgtgctatacgattaga
ttatattggattgtttaa

DBGET integrated database retrieval system