KEGG   Trichinella spiralis: Tsp_00588Help
Entry
Tsp_00588         CDS       T01609                                 

Definition
acetate--CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
tsp  Trichinella spiralis
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tsp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tsp_00588
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tsp_00588
   00620 Pyruvate metabolism
    Tsp_00588
   00640 Propanoate metabolism
    Tsp_00588
Enzymes [BR:tsp01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Tsp_00588
Lipid biosynthesis proteins [BR:tsp01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Tsp_00588
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 717 aa AA seqDB search
MCSFCSVLPVAMSDNVRMATFSIDSEEDEQAILPPPHLSEKAHCSSFSNYLEMYSQSVKD
PEAFWTSFANELTFFKKWETGCFLDYNFDRRKGPVYVRWMPNASLNTAWRQSCILLVTSV
IARLEGNEPGVSMKLTYRELLKLVCKFANVLKRKGVKKGDRVIIYLPMILELPIAMLACA
RIGAVHSTVFGGYSAQALAQRIVDAKAEVVITADGSYRGKKPILLKQITDQAISICEKRY
LACEIELQTLSWSVEQNIQNQLQMNHQLDRYRHVRNVIVKHRIIVRHLADNYTGFPSTQQ
DCKSKLQVQNCWFDEEMSAADENCESEWMDSEDPLFILYTSGSTGVPKGVVHTQAGYLLY
VYTTFRYVFDYQDDDVYFCTADIGWITGHSYVVYGPLANGSTVVMVSGNLLAFEGVPYYP
EPSRYWDVVDKYGVSKFYTAPTAIRHLMKFGSSYVERCRLDRLEVLGSVGEPINPEVWQW
YYKVVGKSRCAIVDTYWQTETGGHVLTPLPGCTNMKPGSASFPFFGVKPVLLNHDGQEIV
GPGEGQLAFSAPWPGIARSLYGNHDRYVDTYFAVPGYFCTGDGCTRDEDGYYWITGRIDD
MMNVSGHLLSSAEIENAVVSHPAVAEAAVVCAPDPVKGQIPYCFVTLKKVGGLRVHRRTG
VGHQADRAQSDWSGGHTRSVPTSRKFAKNAFWENFEACVARCGRRQHDQLRRPEHPV
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atgtgttcgttttgttcagttttaccagttgcaatgtcagacaacgttcgtatggcgaca
ttttcaattgactctgaagaggacgagcaggcaattttgccgccaccgcatttgagtgaa
aaagcccattgtagttctttttccaactatttggaaatgtactcacagtcggtgaaggat
ccggaagcattttggacatcttttgccaatgagctcacctttttcaaaaaatgggagacg
ggatgttttctggactacaattttgaccgtcgaaaaggacccgtttatgtgcgctggatg
ccgaacgcgtcgttgaacacagcttggcgacaaagttgcattttactggtaacaagcgtc
attgctcgattggaaggcaatgagcccggtgttagcatgaagctgacttacagagaattg
ttgaaattggtttgcaaatttgcaaatgttttgaagcggaaaggtgtgaagaagggcgac
cgagtgattatttatttgccgatgatattggaattacccattgcaatgttggcttgtgca
agaattggcgctgtccactctacagtgtttggcggatattcagcccaagctcttgctcaa
cgaattgttgatgcaaaggcggaagttgtgattaccgctgacggcagctacaggggcaag
aaaccgattcttttgaaacagatcactgatcaagctatttctatatgtgaaaagaggtat
ttggcatgtgaaatagagttgcaaactttgagctggtctgttgaacagaacattcaaaat
cagttacagatgaatcaccaattagacagatatcgccatgtgagaaatgtaatcgtgaaa
catcgaattattgtgcggcatttggcggacaattacaccggctttccttcaacgcaacaa
gattgcaaaagcaaactgcaagtgcagaattgttggtttgacgaggagatgtctgctgcc
gatgaaaactgcgaatccgaatggatggacagtgaggatccattgtttattttatacacg
agcggttccactggcgtaccgaagggggttgttcacacgcaagctggctatttgctgtat
gtttacacgacatttcgatatgtatttgactatcaggacgatgacgtctacttttgtacg
gccgatattggctggattactggacacagctacgtagtgtacggtcccctggccaatggt
tcaaccgtggtcatggtgagcggaaatttattggcgttcgaaggtgtgccatattatcca
gagcctagtcgttattgggatgttgtcgataaatatggtgtgagcaaattttacaccgct
cccactgccataagacatttgatgaaatttggttcatcttatgtggaacgatgtcgactg
gatcgacttgaagtgttgggcagtgtcggtgagccgatcaatcccgaagtctggcagtgg
tattacaaagtggtgggaaaatcccgttgcgccattgtcgacacctactggcaaacggaa
acgggtggtcatgttttgacaccgcttccgggatgcacgaacatgaagcctggctctgct
tcgtttccatttttcggcgtcaagccagttctgttgaatcacgacggtcaagaaatagtt
ggacctggtgaagggcaactggctttctcagcgccgtggccaggtattgcgcgttctttg
tatggaaatcatgatcgctacgtggacacttactttgccgttccaggttatttttgcacc
ggtgatggctgcaccagggatgaagatggttattattggatcaccggtcgtattgatgac
atgatgaacgtgtccggacatttgctttcgagtgcggaaattgaaaacgccgtcgtatcg
caccctgcggttgcagaagcggccgtggtttgtgcaccggatccagtgaaaggtcaaatt
ccgtactgtttcgtcacgttgaagaaggtcggtggattacgcgttcaccgccgaactggt
gttggacatcaagcagaccgtgcgcaatcagattggtccggtggccacacccgaagtgtt
ccaacaagccgaaagtttgccaaaaacgcgttctgggaaaattttgaggcgtgtgttgcg
cgatgtggccggcggcaacacgaccagcttcggcgacctgagcaccctgtctga

DBGET integrated database retrieval system