KEGG   Trichinella spiralis: Tsp_00608Help
Entry
Tsp_00608         CDS       T01609                                 

Definition
palmitoyl-protein thioesterase 3
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
tsp  Trichinella spiralis
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Brite
KEGG Orthology (KO) [BR:tsp00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Tsp_00608
  Lipid metabolism
   00062 Fatty acid elongation
    Tsp_00608
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Tsp_00608
Enzymes [BR:tsp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     Tsp_00608
Lipid biosynthesis proteins [BR:tsp01004]
 Fatty acid synthase
  Component type
   Tsp_00608
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 268 aa AA seqDB search
MSPTLFLCVCVISLSCFHELVFADPTPVVMWHGMGKRDSCCNVGGLGAIISVLQREIPGI
YVTDACNQIANDEHLQNGYHAIGRAVAQRCPSPPMKNFISIGGQHQDSSKRSETYVSCEH
FSVIQAQYWHNPLDENTYRDKSIFLAEINNEKVLNQTYIENLQKLQNMVLIKFTRDSMVV
PPESSWFGFYAPGQAVDVIPLQETELYKNNKFIKCHTLAVDAFLKRLPHQRMGDVFFPYY
LDTTMKAQAACQNKSGNEGKKLLDLEQG
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcctacactgttcctctgcgtttgcgtgatttccctttcatgttttcatgaatta
gtgtttgcagatccaactcctgtggtgatgtggcatgggatgggtaaacgcgattcttgc
tgcaatgttggcggcctgggagcaataataagcgtgttgcaaagagaaatacctggaata
tatgttactgatgcgtgcaatcaaattgccaacgacgaacatttgcaaaatggctatcat
gcgattggaagagctgtggctcaacgctgtccatcaccaccaatgaaaaatttcatctcc
attggagggcagcatcaagattcgtccaaaagaagtgagacctatgtcagttgtgaacat
ttcagtgtgattcaagcgcaatactggcataatccgttggatgaaaatacttatcgtgat
aaaagtatttttcttgctgaaataaacaacgaaaaggttttaaaccaaacatacatagag
aacttgcaaaagttgcaaaacatggttttgatcaaatttactcgagattcaatggttgta
cccccagaatcatcatggttcggattttatgcacctggacaagcggtagatgttattcca
ttgcaagagactgaactttacaaaaataacaaattcatcaaatgtcatacactagcagtt
gatgccttcttaaagcggttgccgcatcaacgaatgggtgatgtttttttcccttattac
cttgacacaacaatgaaagcacaagcagcatgtcagaacaaaagcggaaatgaaggcaaa
aaattgcttgacctcgaacaaggctag

DBGET integrated database retrieval system