KEGG   Trichinella spiralis: Tsp_00608Help
Entry
Tsp_00608         CDS       T01609                                 

Definition
palmitoyl-protein thioesterase 3
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
tsp  Trichinella spiralis
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Class
Metabolism; Overview; Fatty acid metabolism [PATH:tsp01212]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:tsp00062]
Cellular Processes; Transport and catabolism; Lysosome [PATH:tsp04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 268 aa AA seqDB search
MSPTLFLCVCVISLSCFHELVFADPTPVVMWHGMGKRDSCCNVGGLGAIISVLQREIPGI
YVTDACNQIANDEHLQNGYHAIGRAVAQRCPSPPMKNFISIGGQHQDSSKRSETYVSCEH
FSVIQAQYWHNPLDENTYRDKSIFLAEINNEKVLNQTYIENLQKLQNMVLIKFTRDSMVV
PPESSWFGFYAPGQAVDVIPLQETELYKNNKFIKCHTLAVDAFLKRLPHQRMGDVFFPYY
LDTTMKAQAACQNKSGNEGKKLLDLEQG
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcctacactgttcctctgcgtttgcgtgatttccctttcatgttttcatgaatta
gtgtttgcagatccaactcctgtggtgatgtggcatgggatgggtaaacgcgattcttgc
tgcaatgttggcggcctgggagcaataataagcgtgttgcaaagagaaatacctggaata
tatgttactgatgcgtgcaatcaaattgccaacgacgaacatttgcaaaatggctatcat
gcgattggaagagctgtggctcaacgctgtccatcaccaccaatgaaaaatttcatctcc
attggagggcagcatcaagattcgtccaaaagaagtgagacctatgtcagttgtgaacat
ttcagtgtgattcaagcgcaatactggcataatccgttggatgaaaatacttatcgtgat
aaaagtatttttcttgctgaaataaacaacgaaaaggttttaaaccaaacatacatagag
aacttgcaaaagttgcaaaacatggttttgatcaaatttactcgagattcaatggttgta
cccccagaatcatcatggttcggattttatgcacctggacaagcggtagatgttattcca
ttgcaagagactgaactttacaaaaataacaaattcatcaaatgtcatacactagcagtt
gatgccttcttaaagcggttgccgcatcaacgaatgggtgatgtttttttcccttattac
cttgacacaacaatgaaagcacaagcagcatgtcagaacaaaagcggaaatgaaggcaaa
aaattgcttgacctcgaacaaggctag

DBGET integrated database retrieval system