KEGG   Trichinella spiralis: Tsp_01211Help
Entry
Tsp_01211         CDS       T01609                                 

Definition
hypothetical protein
Orthology
K12077  
pyruvate dehydrogenase kinase isoform 1 [EC:2.7.11.2]
Organism
tsp  Trichinella spiralis
Brite
Enzymes [BR:tsp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     Tsp_01211
Protein kinases [BR:tsp01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   Tsp_01211
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 404 aa AA seqDB search
MTTLSFGLLLCPCKAWWISKELLVRLANIMKEVELLPSQLMETPSTKLVYQWYQESFQEL
LQYENANADESTLRDFSRQLSRVLKRHNTVVETMAEGLMEMKATHGIDPVTQNNIQYFLN
RFYLSRISVRIRSWLSAHGIWQEFPCTYPKLGIMQIIIFSDEAHPFYTSARHIGCIDPNC
NVVSIIEALDAYENAKFLCDRYYVTSPGMKIETINVLEPSQPISIVYVPSHLYHIMVELL
KNALRAVVEEHGKKDELPPITIRVVKGKEDLSIKGSLRCCRNFQISIFNYKFGLLTVSDQ
GGGVPRHIVGKLFNYMYTTASLPSAENVEYDAPMAGLGYGLPLSRLYARYFLGDLFLFSM
EGYGTDACLYLKASAVDASEMLPWFSFRSKKMYESNEKGPDWSG
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgactacgctcagtttcggccttctgctttgtccatgcaaagcttggtggatttcgaag
gaacttctcgtacgtttggcaaatataatgaaagaagttgaacttcttccatcccagttg
atggaaaccccgtcaaccaagcttgtttatcagtggtatcaggagagttttcaagaattg
ttgcagtatgaaaatgctaatgcggatgaaagcacattgagagacttttcacgacagctt
agcagagttttgaaaaggcataatacagttgtagaaactatggccgagggtttaatggaa
atgaaagcaactcatggaattgatcctgttacgcaaaataatattcaatattttttgaac
cgtttttatcttagtcgcatcagcgtgcgcattcgaagttggttaagtgcacatggaatt
tggcaagaatttccatgcacttatccaaagttaggaattatgcagattatcatcttcagc
gacgaagcacatccgttttacactagtgctcggcatattggatgcattgatccgaattgt
aacgtcgtttctattattgaagctttagatgcttatgagaatgcaaaatttctgtgtgat
cgatactacgttacctctcctggaatgaagattgaaaccataaacgtgctggagccatca
caacctataagcatcgtttacgtaccttcgcatctgtatcacattatggttgaattacta
aaaaatgcattacgcgcagtggtggaagagcatgggaaaaaagatgagttacccccgatt
acaatacgagttgtcaaaggaaaggaagatttatctataaaggggagtttacgatgctgt
aggaattttcaaatcagtatctttaattataaatttggtttgttaacagtaagcgatcaa
ggcggtggagtgcctcggcatattgttggcaaactgtttaattatatgtatactactgct
tcccttccaagtgcggaaaatgttgaatatgacgctccaatggctggactgggttatggt
ttgccgctttctcgactgtatgctcgatattttctaggggatttatttctattctcaatg
gaaggctatggaacagatgcatgcctatatttgaaggcatctgcagttgacgctagcgag
atgttgccatggttttcttttcgttccaaaaaaatgtatgaaagcaatgaaaaaggtcct
gattggtcaggttaa

DBGET integrated database retrieval system