KEGG   Trichinella spiralis: Tsp_01211Help
Entry
Tsp_01211         CDS       T01609                                 

Definition
hypothetical protein
Orthology
K12077  
pyruvate dehydrogenase kinase isoform 1 [EC:2.7.11.2]
Organism
tsp  Trichinella spiralis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 404 aa AA seqDB search
MTTLSFGLLLCPCKAWWISKELLVRLANIMKEVELLPSQLMETPSTKLVYQWYQESFQEL
LQYENANADESTLRDFSRQLSRVLKRHNTVVETMAEGLMEMKATHGIDPVTQNNIQYFLN
RFYLSRISVRIRSWLSAHGIWQEFPCTYPKLGIMQIIIFSDEAHPFYTSARHIGCIDPNC
NVVSIIEALDAYENAKFLCDRYYVTSPGMKIETINVLEPSQPISIVYVPSHLYHIMVELL
KNALRAVVEEHGKKDELPPITIRVVKGKEDLSIKGSLRCCRNFQISIFNYKFGLLTVSDQ
GGGVPRHIVGKLFNYMYTTASLPSAENVEYDAPMAGLGYGLPLSRLYARYFLGDLFLFSM
EGYGTDACLYLKASAVDASEMLPWFSFRSKKMYESNEKGPDWSG
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgactacgctcagtttcggccttctgctttgtccatgcaaagcttggtggatttcgaag
gaacttctcgtacgtttggcaaatataatgaaagaagttgaacttcttccatcccagttg
atggaaaccccgtcaaccaagcttgtttatcagtggtatcaggagagttttcaagaattg
ttgcagtatgaaaatgctaatgcggatgaaagcacattgagagacttttcacgacagctt
agcagagttttgaaaaggcataatacagttgtagaaactatggccgagggtttaatggaa
atgaaagcaactcatggaattgatcctgttacgcaaaataatattcaatattttttgaac
cgtttttatcttagtcgcatcagcgtgcgcattcgaagttggttaagtgcacatggaatt
tggcaagaatttccatgcacttatccaaagttaggaattatgcagattatcatcttcagc
gacgaagcacatccgttttacactagtgctcggcatattggatgcattgatccgaattgt
aacgtcgtttctattattgaagctttagatgcttatgagaatgcaaaatttctgtgtgat
cgatactacgttacctctcctggaatgaagattgaaaccataaacgtgctggagccatca
caacctataagcatcgtttacgtaccttcgcatctgtatcacattatggttgaattacta
aaaaatgcattacgcgcagtggtggaagagcatgggaaaaaagatgagttacccccgatt
acaatacgagttgtcaaaggaaaggaagatttatctataaaggggagtttacgatgctgt
aggaattttcaaatcagtatctttaattataaatttggtttgttaacagtaagcgatcaa
ggcggtggagtgcctcggcatattgttggcaaactgtttaattatatgtatactactgct
tcccttccaagtgcggaaaatgttgaatatgacgctccaatggctggactgggttatggt
ttgccgctttctcgactgtatgctcgatattttctaggggatttatttctattctcaatg
gaaggctatggaacagatgcatgcctatatttgaaggcatctgcagttgacgctagcgag
atgttgccatggttttcttttcgttccaaaaaaatgtatgaaagcaatgaaaaaggtcct
gattggtcaggttaa

DBGET integrated database retrieval system